KEGG   Coprothermobacter proteolyticus: COPRO5265_1313Help
Entry
COPRO5265_1313    CDS       T00773                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cpo00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cpo00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1182758..1183669
Genome map
AA seq 303 aa AA seqDB search
MKHLLGLEKLSRDEILSILHLAAPMKDIILREVKKVPTLRGKIIGTLFYEPSTRTKNSFE
LAAKLLSADVVSVSVATSSVKKGESLKDTVLTLEAMGIEAIVIRHSRNGVPAYLSSCSKA
SIINAGDGQHEHPSQALLDLFTIQQYKGRIEGLKVLIVGDIMHSRVAKSNIYGLSKLGAE
IIVSGPPTLIPEEVKNYAQVEYDLDNAIKKADVVNVLRLQLERQEAGLITSLEEYHRFYG
LTKERMAKAKEDLLVLHPGPMNRGVEIDEEVAYCDKSAIQEQVSNGVAVRMAIYYTLMGG
REE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcttttggggttagaaaagctttcccgcgacgagattttgtccatactgcat
ctggcagctcccatgaaagacattattctaagagaagttaaaaaggtccccactcttcga
ggaaaaataattggcactttgttctatgagccttccaccagaaccaagaactcctttgaa
ctggcagcaaagcttttaagtgctgacgtagtcagcgtcagtgtggctaccagttccgtt
aaaaagggagaaagccttaaagacactgtgctcacgttggaggctatgggcattgaagcc
atcgtcataaggcatagtaggaacggtgtgccagcttacttgtccagctgttcaaaggct
tctattattaacgcaggtgatgggcagcatgaacatcccagccaagcacttttggatttg
ttcaccattcagcaatacaaaggacgcatagaaggcttaaaagtactcatagtgggggat
attatgcacagcagagtagcaaaatccaatatctatggcttgagtaagttaggagcagag
atcattgtttcaggcccccctactctgattccagaggaagttaagaattatgcccaggta
gaatacgacttggacaatgcaatcaagaaagcagatgttgttaacgtgcttaggctgcag
ctggaacgtcaggaagctgggctcataacgtcattagaggaataccatcggttctacggc
cttaccaaagagagaatggcaaaagcaaaagaagacctacttgtactccacccagggccc
atgaatagaggggtggaaatcgatgaagaagtagcttactgcgacaagagtgccatacaa
gaacaagtgtccaacggtgttgccgtaagaatggcaatttactatacgctgatgggaggt
agggaggaatga

DBGET integrated database retrieval system