KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_0099Help
Entry
CpP54B96_0099     CDS       T01771                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cpp00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(91310..92839)
Genome map
AA seq 509 aa AA seqDB search
MQYVAAIDQGTTSTRCIIFDHDGNQVSVGQYEHEQIFPQKGWVEHDAIEIWDNTRRAVGT
ALADSDLSAKDIAALGITNQRETTVVWDKNTGEPVYNAIVWQDTRTTSICKELAGDEGAD
RWYRKTGLLINSYPAGPKIKWILDNVDGARERAEAGELLFGTIDTWLLWNLTGGADGDDG
APALHATDVTNASRTLLMDIEKLEWDKELCKAMDIPMEMLPEIRPSVGDFHQVRERGSLS
GVPIRSMLGDQQAAMFGQGCFRPGEAKNTYGTGLFLLLNTGTTPKWSENGLLTTVCFQIE
GQKPVYALEGSVAAGGSLVQWLRDNLMLVPNAPMIENMARSVEDNGGVYIVPAFSGLFAP
YWRQDARGVIVGLTRFVNRNHLARAVLEATAYQTRDVADAMVADSDVKLTELRVDGGMTY
NELLMQFQADILGVPVTRPKNVETTATGAAFAAGYSVGYWENLDFLTQQKGDLHVWKPTM
DQEKVDELYHDWKRAVKRSLNWEENVDEF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatgtagcagccatcgaccaaggcactacttcaacccgctgcatcatctttgac
catgacggcaaccaggtctccgttggtcaatatgaacacgaacaaatcttccctcaaaaa
ggctgggtagagcatgacgccatcgaaatctgggacaatacccgccgcgcagtagggacc
gcccttgcagacagcgacctgtcagctaaagacatagcggccctaggcatcactaaccag
cgcgaaaccacagtggtctgggacaaaaacaccggcgagcccgtgtacaacgccatcgtg
tggcaagacactcgcaccacctcaatctgcaaagaactcgctggtgatgaaggcgctgac
cggtggtaccgcaagaccggcctcctcatcaattcttatcccgctggtcccaaaatcaag
tggattctagacaacgttgacggcgcccgcgagcgagccgaggcaggagaactcctcttt
ggcaccatcgacacatggctcctctggaacctcaccggcggcgccgatggcgatgacggc
gcaccggcattgcacgcaaccgacgtgactaatgcttcccgcaccctcctcatggatatt
gaaaaactggagtgggacaaagaactctgcaaagccatggatatccccatggaaatgctc
cctgagatacgtccatcagtcggcgatttccatcaagtacgtgaacgtggatcgctctcc
ggggttcccattcgatcaatgcttggcgaccaacaagccgccatgttcggccaaggttgt
ttccgtccaggtgaggcaaaaaacacctacggaacaggcctcttcctgctcctcaacaca
ggaaccacccctaagtggtccgaaaacggcttgctcaccacagtttgcttccaaattgaa
ggccaaaaaccggtctacgcattggaaggttcagttgctgcaggaggatcgctagtccag
tggctgcgcgataacctcatgcttgtccccaacgctcctatgatcgagaacatggcacgc
agcgttgaagacaacgggggcgtctatatcgttccagctttctccggacttttcgcgcca
tactggcgacaagacgcccgaggcgtcatcgtcggactcactcgctttgttaaccgcaat
cacctagctcgcgccgttttggaagcaaccgcataccaaacccgcgacgttgcagacgcc
atggtcgccgactcagatgtgaagctcactgaacttcgtgtcgacggcggaatgacctac
aacgaactcctgatgcagttccaggcagatatccttggcgtcccggttactcgccctaaa
aacgtggagaccacggccaccggagccgcctttgccgccggttattctgtcggctactgg
gaaaatcttgatttcctcactcagcaaaaaggcgatttacacgtctggaagcctacaatg
gatcaggaaaaagtcgacgagctttaccacgattggaagcgcgcagtaaagcgttccctg
aactgggaagaaaatgtagacgagttctag

DBGET integrated database retrieval system