KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_0262Help
Entry
CpP54B96_0262     CDS       T01771                                 

Gene name
gpmA
Definition
(RefSeq) Phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cpp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CpP54B96_0262 (gpmA)
   01230 Biosynthesis of amino acids
    CpP54B96_0262 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpP54B96_0262 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CpP54B96_0262 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CpP54B96_0262 (gpmA)
Enzymes [BR:cpp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CpP54B96_0262 (gpmA)
Exosome [BR:cpp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CpP54B96_0262 (gpmA)
  Exosomal proteins of melanoma cells
   CpP54B96_0262 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
273948..274724
Genome map
AA seq 258 aa AA seqDB search
MRNFRGKLSIMTIGKLILLRHGQSEWNASNQFTGWVDVNLTEQGEAEAKRGGEMLKQQDV
LPTVVYTSLLRRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKDKYGAD
QFMEWRRSYGTPPPELEDSSEFSQANDPRYADLSQVPRTECLKDVVERFVPYFEEEILPR
AKKGETVLIAAHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDQEGKVLNPGGTYL
DPEAAAAGAAAVAAQGGK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaattttcgtggcaaactgagcattatgactatcggaaaactgattcttctccgc
cacggacaaagcgagtggaacgcctccaaccagttcacgggttgggtggacgttaacctt
actgagcaaggcgaggccgaggccaagcgcggcggcgagatgctgaagcaacaagatgtt
ttgccaactgttgtttatacttctcttcttcgtcgcgcaatccgcaccgccaacatcgca
ctcaacgcggcggatcgtcattggatcccggtcgtgcgcgattggcgcctcaacgagcgt
cactatggtgcgttgcagggtctgaacaaggctgagaccaaggataagtatggcgcagat
cagttcatggaatggcgccgttcttacggcacccctcctccggagttggaagactcaagt
gagttttctcaggcaaacgacccccgctacgccgatctgtctcaggttcctcgcacggaa
tgcctcaaggacgttgtagaacgttttgtgccttattttgaagaggaaattttgccacgg
gcgaaaaagggcgagactgtcctcatcgcagcgcatggtaattccttgcgtgcattggtc
aaacaccttgacaatatctcggatgcagatatcgcggagctgaatattcctaccggaatt
ccgctggtatacgagctggaccaggaaggaaaggttcttaacccgggtggtacctacctt
gatccagaggcagcggcagcaggagctgcggcagttgctgcgcaaggcggcaaataa

DBGET integrated database retrieval system