KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_0279Help
Entry
CpP54B96_0279     CDS       T01771                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CpP54B96_0279 (hemD)
Enzymes [BR:cpp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CpP54B96_0279 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CpP54B96_0279 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
287337..289031
Genome map
AA seq 564 aa AA seqDB search
MFMSSTPQPTPVTPAPEGKVIFVGAGPGNPDLLTVRAREVLSHTAFAVVDAEVLPGVRSV
VARELDVPMDKVQAAEEEYERLCAEAKEAGARRKPQRPDAPTAAEITEVDDDVPVVEVVE
KLKELLSSGEDVIRLVQGNPLSCDRTLEEISAVKQAGLEFHVVPGMSLPATVPAFAGIAL
GSSYTETDVTGEDVDWEQLAAAPQPLVLQATKEDLPTIAAELKSRGIEASTPVTVTARGT
TRLQRSFDISLGALHKLDGDLAGTLVVTLGKAADERTKYSWWENRSLFGWRVLVPRAKEQ
AGSMSALLAAQGAIPQEVPTISVEPPRNPAQMEKAVKGIVEGRYQWVIFTSVNAVKSVRE
KIGSFGLDARAFAGVRIGAVGTKTAKAIRELGITPELLPPRNRQNAAGLVSVFPEYVEDL
DPVGRVLLPRADIATDVLVEGLEGLGWEVDDVVAYRTVRAAPPSAEVRDMIKSGGFDAVC
FTSASTVKNLVGIAGKPHQRTIIACIGPMAAAAAKELGLRVDVIPEVADVPHLINGLATH
VAQLRAAGQLPPPRKKRRARKNRE
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
ttgttcatgagttcgactccgcaacccaccccggtaacccctgcaccggagggaaaagtg
atctttgtaggagcaggaccaggaaaccctgatctgctcaccgttcgcgcccgcgaagtt
ctcagccataccgcttttgccgtagtagatgcagaagttctaccgggggttcgctcagtg
gttgcacgtgaactcgatgtgccgatggataaagttcaggcggctgaggaagaatacgag
cggctgtgcgcggaagcaaaagaagctggtgcgcgccgtaaaccgcagcgcccggacgcc
ccgactgccgctgagattacagaagtagacgacgacgttcctgtagtagaggtagtggaa
aagcttaaggagcttttgtccagcggggaagacgttattcgcctggtgcagggaaacccc
ttgtcatgtgaccgaaccctggaagaaatttctgcggtcaagcaggccggactggagttc
cacgtggttcccggcatgtccttgccggcgaccgttcctgcttttgcgggtatcgctctg
ggctcttcttatacagaaaccgatgtaactggggaagacgtagattgggaacagcttgct
gcagcacctcagccgctggttttgcaggcaactaaagaggatctgcctacaatagccgca
gagttaaaatctcgtgggatagaggcatcgaccccggtgacggtgacagctcgcgggaca
acacgcttgcaaagaagttttgatattagtttgggcgccctgcacaagttggacggggac
ctcgccggaaccctcgtggttactttaggcaaagcagcggatgaacgtaccaagtattct
tggtgggagaaccgttcgctctttggttggagagtgctggtcccccgtgcaaaagaacaa
gccggatcaatgagtgcattgttggctgctcagggggcaatcccgcaagaagttcccaca
atctctgtggagccgccacgtaatcctgcgcaaatggagaaggccgttaaagggatcgtg
gaaggccgctaccaatgggtgatttttaccagcgtcaacgcagtgaaatccgtgagagag
aaaatcggttccttcggactcgatgctcgtgcctttgctggcgtgcgcattggagcggta
ggaacaaaaactgctaaggccatccgtgagcttggaatcacgccggagttgctccctccg
agaaatcggcaaaacgctgcaggtttagtgtcagtgttcccggagtatgtggaagacctt
gatccagtcggacgggtcctcttgccccgggcggatattgcaacggacgtcctggtggaa
ggcttagaaggccttggctgggaggtcgacgatgtggtggcgtatcgcacggtacgggcc
gccccgccgagtgcagaagtgcgcgacatgattaaaagtggcggttttgacgctgtgtgc
tttacctctgcatccacggtaaaaaatctggtgggcattgctgggaaaccacatcagcgc
acaatcattgcatgcattggtccgatggcggcggcagcggcaaaagaattaggcctgcgg
gtggacgtgatccccgaggtagcggatgttcctcacttgattaatggtcttgctacccac
gtggcacaactgcgcgcagctggccagctgccgcctcctaggaagaagcggcgcgcccga
aaaaatcgcgagtaa

DBGET integrated database retrieval system