KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_0642Help
Entry
CpP54B96_0642     CDS       T01771                                 

Gene name
folA
Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cpp00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cpp00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(667925..668452)
Genome map
AA seq 175 aa AA seqDB search
MLRAIWAQSRDGVIGNGSDMPWHLPEDLAHFKKTTLGCPVIMGRKTWESLPPTFRPLPGR
QNYVLSRSAAGPWSTGACVVSTLPDVTGAWIMGGGQIYDATLPKVKEVVRTIVDVELLDV
LGESAVSAPALGSEFEIVSETEWMASISGKLHREYQDSASSQPLRYKFQSLRRTA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgggcaatttgggcacaatcccgcgacggggtcattggcaatggaagcgatatg
ccctggcatctgcccgaggatctcgcccactttaaaaagaccactctgggctgcccagtg
atcatgggacgcaagacgtgggaatcgctgcccccaacttttcggcctcttcctgggcgc
caaaactatgtgctgtcccgctcagcagccggcccgtggagtaccggtgcttgcgtggtg
agcacgttacccgatgtaacaggcgcgtggatcatgggaggcggacaaatttatgatgcg
acgctaccaaaggttaaggaggtagtgcgcactatcgtggacgttgagcttctcgacgtc
ctcggcgaatccgcggtttccgctcctgcgcttggctccgagtttgagatcgtatcggaa
actgagtggatggcgtcgataagcggaaaactgcaccgagaataccaggactcggcctcc
tcacaaccactgcgctacaaattccaaagtttgcgacgcactgcctaa

DBGET integrated database retrieval system