KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_0679Help
Entry
CpP54B96_0679     CDS       T01771                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
cpp00040  Pentose and glucuronate interconversions
cpp00052  Galactose metabolism
cpp00500  Starch and sucrose metabolism
cpp00520  Amino sugar and nucleotide sugar metabolism
cpp01100  Metabolic pathways
cpp01130  Biosynthesis of antibiotics
Module
cpp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CpP54B96_0679 (galU)
   00052 Galactose metabolism
    CpP54B96_0679 (galU)
   00500 Starch and sucrose metabolism
    CpP54B96_0679 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CpP54B96_0679 (galU)
Enzymes [BR:cpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CpP54B96_0679 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFF21823
Position
704292..705221
Genome map
AA seq 309 aa AA seqDB search
MKQPQEAQDSTRVAVKTVIVPAAGMGTRFLPATKTVPKELLPVVDTPGIELIAEEAAQLG
ATRLAVITAPNKQEVMEHFKRFPVLEETLQSRGKTEQYEKVVHASELIAPVSVVQEKPLG
LGHAVGMAESVLDPDEDAVAVMLPDDLVLPRGVVEKMVEVREQLGGSVLCAFEVPEEEVY
NYGVFEIDESAYDGPHHVKKVKGMVEKPSVEEAPSNFVATGRYLLDRAIFDALRRITPGA
GGELQLTDAIDLLIDEGHPVHILVHDGKRHDLGNPGGYIPAVVDFGLRDPAYGPHLKKVL
RKILEEHGA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcctcaagaagctcaagacagtacgcgcgtcgcggtgaagactgtcatcgtt
cctgctgctggcatgggaacgagattccttcctgccacaaaaacggttcctaaagaactg
ttaccagtggtagataccccaggcattgaactgattgcagaagaagcagctcagttgggg
gcaactcgactcgcagtaattacggctcctaataagcaggaagtcatggagcactttaag
cgattcccagtgttggaagagaccctacaaagccggggcaaaaccgaacaatatgaaaaa
gttgttcatgcctctgagcttattgcgccagtttccgtagtgcaggaaaagccgctcggc
cttgggcatgctgttggcatggcggaatcagtccttgatcctgatgaggatgccgtagca
gtcatgcttcccgatgatctagtgcttccgcggggcgttgtggagaagatggtcgaggta
cgcgagcaactaggcggatccgtgttgtgcgcctttgaagtgccggaggaagaagtctat
aactacggtgtctttgagatcgatgagagtgcatatgatggccctcatcacgtcaaaaaa
gtcaaaggaatggtagaaaaaccctctgtagaagaggctccttcaaattttgtggctacc
ggccgctatttgctcgatcgggctatttttgatgcactccgtagaattaccccgggtgct
ggcggtgagctgcaactcacggatgccattgatttgcttatcgacgaaggccatcctgtg
catattcttgtgcatgacgggaagcgtcatgatcttggcaaccccgggggatacataccg
gctgttgttgattttgggttgcgcgatccagcgtatgggccgcacttaaagaaggtcctc
cgaaagattttggaagaacacggcgcataa

DBGET integrated database retrieval system