KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_0679Help
Entry
CpP54B96_0679     CDS       T01771                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cpp00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cpp00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cpp00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cpp00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
704292..705221
Genome map
AA seq 309 aa AA seqDB search
MKQPQEAQDSTRVAVKTVIVPAAGMGTRFLPATKTVPKELLPVVDTPGIELIAEEAAQLG
ATRLAVITAPNKQEVMEHFKRFPVLEETLQSRGKTEQYEKVVHASELIAPVSVVQEKPLG
LGHAVGMAESVLDPDEDAVAVMLPDDLVLPRGVVEKMVEVREQLGGSVLCAFEVPEEEVY
NYGVFEIDESAYDGPHHVKKVKGMVEKPSVEEAPSNFVATGRYLLDRAIFDALRRITPGA
GGELQLTDAIDLLIDEGHPVHILVHDGKRHDLGNPGGYIPAVVDFGLRDPAYGPHLKKVL
RKILEEHGA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcctcaagaagctcaagacagtacgcgcgtcgcggtgaagactgtcatcgtt
cctgctgctggcatgggaacgagattccttcctgccacaaaaacggttcctaaagaactg
ttaccagtggtagataccccaggcattgaactgattgcagaagaagcagctcagttgggg
gcaactcgactcgcagtaattacggctcctaataagcaggaagtcatggagcactttaag
cgattcccagtgttggaagagaccctacaaagccggggcaaaaccgaacaatatgaaaaa
gttgttcatgcctctgagcttattgcgccagtttccgtagtgcaggaaaagccgctcggc
cttgggcatgctgttggcatggcggaatcagtccttgatcctgatgaggatgccgtagca
gtcatgcttcccgatgatctagtgcttccgcggggcgttgtggagaagatggtcgaggta
cgcgagcaactaggcggatccgtgttgtgcgcctttgaagtgccggaggaagaagtctat
aactacggtgtctttgagatcgatgagagtgcatatgatggccctcatcacgtcaaaaaa
gtcaaaggaatggtagaaaaaccctctgtagaagaggctccttcaaattttgtggctacc
ggccgctatttgctcgatcgggctatttttgatgcactccgtagaattaccccgggtgct
ggcggtgagctgcaactcacggatgccattgatttgcttatcgacgaaggccatcctgtg
catattcttgtgcatgacgggaagcgtcatgatcttggcaaccccgggggatacataccg
gctgttgttgattttgggttgcgcgatccagcgtatgggccgcacttaaagaaggtcctc
cgaaagattttggaagaacacggcgcataa

DBGET integrated database retrieval system