KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_0694Help
Entry
CpP54B96_0694     CDS       T01771                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cpp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CpP54B96_0694 (ispE)
Enzymes [BR:cpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CpP54B96_0694 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
722304..723263
Genome map
AA seq 319 aa AA seqDB search
MIEENPELKHGKRITATAHSKVNLHLGVGPRRHDGYHELVTIFQSLSLKDEVECVELRGT
ATDQKSGIVAELDAYEADGVPTDNSNLAWKAADMVYAFHRSGGGPPLNKVRICLKKGIPT
AGGMAGGSADAAAALRLMQEYVTVKPTDKQLLTMASALGSDVPFTLLGGTRLGTGRGENL
VHVMSRGQYHWALAFSTQGLSTPAVFAKLDQMQRTPHLSVDDLTAALISGDPYHVAQYLH
NDMQPAALSLQPGLRKTLEVGKASGALAGIISGSGPTCAFLCPDAESAEDVAAELRLIGP
AATATGPALGATISTTTRS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgattgaggagaatccggagcttaagcacggcaaacgcatcacagcaaccgcgcattca
aaagtgaacctccaccttggagtgggcccgcggcgccacgacggctatcacgagcttgtc
actatttttcaatctttgagccttaaagatgaagtggaatgcgtagagctacgcggaact
gcaaccgatcaaaaatccggaatcgtagctgagcttgacgcctatgaggctgacggagtt
cctaccgataacagcaatcttgcgtggaaagccgccgatatggtctatgcttttcatcgt
tctgggggcggacctcccctgaacaaagtacggatctgcttaaaaaagggaattcctaca
gccggcggcatggcaggaggctcagcagacgctgctgcggcgcttcggcttatgcaggaa
tacgtcacagtaaaaccaactgataagcagctactcactatggccagtgccttaggatcg
gacgttcctttcacgcttttaggcggcacgcggctgggaaccgggcgtggagaaaacctc
gttcacgttatgtcccgaggccaatatcattgggcgttagctttttctacacaaggtctt
agcactcctgcggtctttgccaagctagatcagatgcaacgcaccccgcacttatccgta
gatgatctgacagcagcgctgattagcggagacccgtaccacgtagctcagtatcttcac
aacgatatgcaacctgcagctctttcccttcagccaggtttgagaaaaactctggaggtg
ggtaaggcctcaggtgcgctggcagggattatttctggctctggccccacctgcgctttt
ctttgcccggatgcggaaagcgccgaggacgtagccgcagagctgcggcttataggacca
gctgcaaccgcaacaggtccagcgctaggcgctaccatttccaccacaaccagatcatag

DBGET integrated database retrieval system