KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_0790Help
Entry
CpP54B96_0790     CDS       T01771                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpp01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cpp00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
824592..825620
Genome map
AA seq 342 aa AA seqDB search
MLDLTADPIELTRVLVDIESPSHHEEHIADLIEQALKSIPNVEVLRHGNTVVARTHRGLG
SRVILAGHIDTVPTADNVPSTLIDDVLFGCGTVDMKSGMAVYLHAFATLANSQELAQDLT
IVCYEGEEVSSEYNGLGHLQQAHPEWLQGDIALLGEPSGAVIEAGCQGSIRLRITAHGVR
AHSARSWLGTNAMHLLAPVISRIANYEAQEKLVDACLYHEGLNIVHCESGVATNTIPDEA
WMFVNFRFAPDRSLDDAMAHLLETLSLPSGVSYEVDDAVPGARSGLDRPAAVSLLRATGG
KFRAKYGWTDVSRFSEMGIPAVNFGPGDPRTAIRKTSSARFT
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgttggacttgactgctgaccctattgaattaacccgtgtactggtggacattgaaagc
ccctctcaccacgaggagcatattgcggatctgatcgaacaggccttgaagtccattcct
aacgtagaagtactgcgtcatgggaataccgtggttgcgcgcacccatcggggactagga
agcagagttatcctagccggacacatcgacaccgtacccacagcagataatgttccttcc
actctcatcgatgacgtactttttggctgtggaaccgtcgacatgaaatccggcatggct
gtatatctgcatgcttttgccacccttgctaattcccaagaattagcacaagaccttacg
atcgtttgctatgaaggcgaggaagtctccagcgaatacaacggattaggtcatctgcaa
caagcacaccctgaatggcttcaaggtgatatcgccttactaggagagccatcaggagca
gtcatcgaagcaggatgccaaggatctattcgtctccggatcacggcgcacggtgtgcga
gcgcattctgcgcgttcgtggctaggaacgaacgccatgcatctcctagcgcctgttatc
tcccgtatcgcgaattatgaggctcaggaaaaacttgtcgacgcctgcctctaccacgag
ggactcaatatcgtgcactgtgaatctggtgtagccactaacacgattcccgatgaagcc
tggatgtttgtaaacttccgttttgccccggaccgcagcctggacgatgcgatggcgcat
ttgctggagaccctctcccttcctagcggggtgagctatgaggtggatgacgcggtgccg
ggagcgcggtcgggactggaccgtccggctgctgtctctctcctacgcgcaacgggcgga
aaatttcgtgctaaatatggttggactgatgtgtctcgtttttctgaaatgggaattcct
gcagtgaattttggcccgggtgaccctcgtactgccataagaaagacgagcagtgcccgg
ttcacatga

DBGET integrated database retrieval system