KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_0790Help
Entry
CpP54B96_0790     CDS       T01771                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CpP54B96_0790 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    CpP54B96_0790 (dapE)
Enzymes [BR:cpp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CpP54B96_0790 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
824592..825620
Genome map
AA seq 342 aa AA seqDB search
MLDLTADPIELTRVLVDIESPSHHEEHIADLIEQALKSIPNVEVLRHGNTVVARTHRGLG
SRVILAGHIDTVPTADNVPSTLIDDVLFGCGTVDMKSGMAVYLHAFATLANSQELAQDLT
IVCYEGEEVSSEYNGLGHLQQAHPEWLQGDIALLGEPSGAVIEAGCQGSIRLRITAHGVR
AHSARSWLGTNAMHLLAPVISRIANYEAQEKLVDACLYHEGLNIVHCESGVATNTIPDEA
WMFVNFRFAPDRSLDDAMAHLLETLSLPSGVSYEVDDAVPGARSGLDRPAAVSLLRATGG
KFRAKYGWTDVSRFSEMGIPAVNFGPGDPRTAIRKTSSARFT
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgttggacttgactgctgaccctattgaattaacccgtgtactggtggacattgaaagc
ccctctcaccacgaggagcatattgcggatctgatcgaacaggccttgaagtccattcct
aacgtagaagtactgcgtcatgggaataccgtggttgcgcgcacccatcggggactagga
agcagagttatcctagccggacacatcgacaccgtacccacagcagataatgttccttcc
actctcatcgatgacgtactttttggctgtggaaccgtcgacatgaaatccggcatggct
gtatatctgcatgcttttgccacccttgctaattcccaagaattagcacaagaccttacg
atcgtttgctatgaaggcgaggaagtctccagcgaatacaacggattaggtcatctgcaa
caagcacaccctgaatggcttcaaggtgatatcgccttactaggagagccatcaggagca
gtcatcgaagcaggatgccaaggatctattcgtctccggatcacggcgcacggtgtgcga
gcgcattctgcgcgttcgtggctaggaacgaacgccatgcatctcctagcgcctgttatc
tcccgtatcgcgaattatgaggctcaggaaaaacttgtcgacgcctgcctctaccacgag
ggactcaatatcgtgcactgtgaatctggtgtagccactaacacgattcccgatgaagcc
tggatgtttgtaaacttccgttttgccccggaccgcagcctggacgatgcgatggcgcat
ttgctggagaccctctcccttcctagcggggtgagctatgaggtggatgacgcggtgccg
ggagcgcggtcgggactggaccgtccggctgctgtctctctcctacgcgcaacgggcgga
aaatttcgtgctaaatatggttggactgatgtgtctcgtttttctgaaatgggaattcct
gcagtgaattttggcccgggtgaccctcgtactgccataagaaagacgagcagtgcccgg
ttcacatga

  All links  
No link information was found.   
DBGET integrated database retrieval system