KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_1314Help
Entry
CpP54B96_1314     CDS       T01771                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CpP54B96_1314
Enzymes [BR:cpp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CpP54B96_1314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1411071..1412153)
Genome map
AA seq 360 aa AA seqDB search
MGTCGRTLYPFSAVVGQERLRLALLLCAISPRIGGVVIRGEKGTAKTTTVRAFARLLGEA
PLVDLPIGATEDRVVGSLDMETVLTTGKARYNPGLLSQADGGVLYVDEVNLLADHLVDSL
LDAAATGQVTVERDGISYSSPANFVLVGTMNPEEGELRPQLLDRFGLAVDVMASKDTDVR
AEIMRRRLAFESAPQSFAQAWSHEDASTALQIQKAKQRVQQLQLSNVNLNRIAHLCAAFD
VDGMRADLVIARTALAHAAWRGASMVEDEDIRIAAELALPHRRRRDPFDEPGLDQEQLDQ
EMEKARDQHPDASDKAEEPQEEKEQHTLENKSSETQSEQPTSDGQEECATTGAPFRSTGA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggcacctgtggacgcacactatatcctttctctgcagtagtagggcaggagcgatta
agactggcattactcttatgcgcaatttctccgcgtattggtggtgtagttatccgcggg
gaaaagggaacagcgaagaccactacggtgcgagcttttgcgcgtttgctaggagaagcc
cctttagttgatctccctatcggtgccacagaggatcgagtcgtggggtccctggatatg
gagacagtcttgaccaccggaaaagctcgctataacccgggcttgcttagtcaagcagac
ggtggggtgttgtacgtcgatgaggtaaatctcctcgcagatcacctcgtcgattcgctc
ttagacgcggcggcaacggggcaagtaacagttgaacgggatggcatttcttattcttct
cctgccaactttgtgctcgtggggacaatgaacccagaagaaggcgagttgcggccgcaa
ttgcttgatcgtttcggattggctgttgacgttatggcgtccaaagacactgatgtacga
gcagaaataatgcggcgtcggcttgctttcgaatcagccccgcaatcttttgctcaagcg
tggtcccatgaggatgcatcgacggcgctgcaaatacagaaggcgaaacaacgagtgcag
cagttacaactttctaacgttaatctgaaccggatcgcacatttgtgtgcagcatttgac
gtggacggtatgagagctgatttggttatcgctcgaactgcgctagcacatgctgcctgg
cgcggagcttcaatggttgaagatgaggatatccggatagccgcagagttggccttgccg
catcgccgtcgcagagacccattcgatgagcctggcctagaccaggaacagctggatcaa
gaaatggaaaaagcccgggatcagcaccctgacgccagtgataaagcggaagagcctcaa
gaggaaaaagagcagcatacactagagaacaagtcttcggagactcaatctgagcagccc
accagtgacggtcaggaggaatgcgctactactggcgctccctttcgctccacgggtgct
taa

DBGET integrated database retrieval system