KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_1504Help
Entry
CpP54B96_1504     CDS       T01771                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
cpp00260  Glycine, serine and threonine metabolism
cpp00750  Vitamin B6 metabolism
cpp01100  Metabolic pathways
cpp01110  Biosynthesis of secondary metabolites
cpp01120  Microbial metabolism in diverse environments
cpp01230  Biosynthesis of amino acids
Module
cpp_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cpp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CpP54B96_1504 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CpP54B96_1504 (thrC)
Enzymes [BR:cpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CpP54B96_1504 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AFF22632
Position
complement(1620405..1621847)
Genome map
AA seq 480 aa AA seqDB search
MHYISTRDTSQTPVAFTDILLGGLAPDGGLYLPEYYPRLDAATLDTWRGILAQQGYAALA
AEVLKLFVDDIPAEDLEAITARAYTTPKFSDEEIVPVTKLEDGIYIGHLSEGPTAAFKDM
AMQLLGELFEYELLRRKETLNILGATSGDTGSSAEYAMRGRAGIRVFMLTPKDRMTPFQQ
AQMFGLDDPNIFNIALEGVFDDCQDVVKAVSSDAEFKADNHIGAVNSINWARLMAQVVYY
ISLWLKVTEKSNQKVSFCVPTGNFGDICAGHIAKQMGLPIDRLIVATNENDVLDEFFRTG
EYRVRSAAETLETSSPSMDISRASNFERFIFDLLGRDSERCAELFGEQVKAGGFSLAEDD
SFEQAATHYGFASGSSTHADRIATIADCYTRRGLMLDPHTADGVKVAREWATQIESPIVC
LETALPVKFTDTIVEAVGRGPEIPERFTGILEAQRHVTDLPNDVVAVKNFILESIARDSA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgcactacatttcgacaagagacacttcccagacccctgtagcgtttactgacatcctc
ttgggaggtctcgctccagatggtggtttgtatcttcctgagtattacccgcgtctcgac
gctgccaccctagacacctggcgcggcattcttgcccagcaaggctatgcggcgctagca
gcagaagtgcttaagctctttgtcgacgacatcccggctgaggatctagaagctattact
gcgcgcgcttatacaacgcctaagttttccgatgaggaaatcgttccggtgaccaagctt
gaggatggcatctatataggtcacctctctgaggggcccactgctgcatttaaagatatg
gccatgcagctccttggcgagctctttgagtatgagttgctacgacgcaaggaaacttta
aacatcctgggtgctacctctggcgacacaggttcttctgcggaatacgctatgcgcgga
cgcgccggtatccgagtgttcatgcttacccctaaagatcgtatgacgccgtttcagcag
gcccagatgtttggtctagacgatccgaatatcttcaatattgccttagagggtgttttt
gatgactgccaagacgtggtcaaagcggtatcttcagacgcagaatttaaagcagacaac
catatcggcgcggtgaactcaattaactgggctcgcttgatggctcaagtggtgtactac
atttctttgtggctcaaagtaactgagaaaagcaatcaaaaagttagtttctgtgttccc
accggcaattttggtgatatctgcgcagggcatatagctaaacaaatgggattgcccatt
gacaggctcatcgttgctaccaatgaaaacgatgtcctggatgagtttttcagaactggt
gaatatcgtgtgcgttctgcggctgagacccttgagacctcctcgccctcgatggatatt
tctcgggcatccaactttgagcgttttatttttgacctattaggaagagactccgagcgc
tgcgcagaactattcggggagcaagtaaaggccggcggtttctctctcgcagaggacgat
tcatttgaacaagctgccacccattatggttttgcgtcgggcagctctactcacgcagac
cgcatagccaccattgccgattgttatacgcgccggggcctgatgttggaccctcatacc
gctgatggtgtgaaagttgcgcgcgagtgggccactcagattgaaagccctattgtctgc
ttggaaaccgccctgccagttaaatttacggatactatcgttgaggccgtggggcgtggt
cctgagataccagagcgttttactgggattctcgaggcacaacgccatgtcaccgatctg
cctaatgacgttgttgcggtgaagaactttattctggaaagcattgctcgggactctgcg
taa

DBGET integrated database retrieval system