KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_1667Help
Entry
CpP54B96_1667     CDS       T01771                                 

Gene name
yddQ
Definition
Isochorismatase family protein yddQ
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CpP54B96_1667 (yddQ)
Enzymes [BR:cpp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CpP54B96_1667 (yddQ)
    3.5.1.-  
     CpP54B96_1667 (yddQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1796697..1797359
Genome map
AA seq 220 aa AA seqDB search
MSTTLTPFLTPIQRSSMQRVFSYAFCTILVPSQKENMRALIIVDVQNDFCPGGALETVKG
AIQAQSIAEYTASHRGKYDCIAATKDWHIDPGDHFSQTPDFIDSWPVHCIANTEGADFHP
LLSNMHFDEVFYKGHYSAAYSGFEGSTASGELLGEWLKNRGIREIDIAGIATDYCVQATA
LDGLREGFRVTVLSHLCAAVNEDNTHTVLHQLKEHGCVLV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
ttgtccacaacacttaccccctttttaaccccaatacagcgttcttccatgcagcgtgta
ttctcatatgcattttgtactatccttgtgccctctcagaaagaaaatatgcgagccctc
atcattgttgacgtccaaaatgacttttgtccgggaggggcgttagaaacggtcaagggc
gcaatccaagcacaatccattgcagaatacacggcgtctcataggggaaaatacgactgc
atcgcagccaccaaagattggcacattgaccccggcgatcatttttctcagacaccagac
tttattgactcctggcctgtacattgcatagccaacacggaaggcgccgattttcaccca
ttgctctcaaacatgcactttgatgaggttttttataaggggcactatagtgcggcttac
tcggggttcgaggggtccacagcatctggagagttattaggtgaatggttaaagaatcgc
gggatacgcgagattgatatcgcgggaatcgctacggattattgcgttcaggctacggct
cttgacggtttaagagaaggcttccgtgtgacggtgctctcgcacctttgcgccgcagtc
aacgaggacaacacccacacagttttgcatcagcttaaagagcatggatgtgtccttgtt
tag

DBGET integrated database retrieval system