KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_1820Help
Entry
CpP54B96_1820     CDS       T01771                                 

Gene name
folP1
Definition
Dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cpp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1961848..1962630)
Genome map
AA seq 260 aa AA seqDB search
MTEVMGIVNVTTDSFSDGGKYLDVDSAVAHAKKLVAEGADIIDVGGESTRPGATRVSEEV
ELARVIPVITALHAEGIKTSVDTMRASVAAAAAEAGAGLLNDVSGGLADKNMYSVMADTE
LPVCLMHWKTTTFGDASGAHHTDVVRDVREGLNVLVDNALAAGVDAQAIAIDPGLGFAKT
AEDNWALLNALPEFMSNYPVLLGASRKRFLASLGVDTDAATAAVTAIAAHHGVWCVRVHN
VALSRAAVDVAAKWRNHGSH
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagtaatgggaatcgtcaacgtaaccaccgattccttttctgatggtgggaaa
taccttgacgtagattccgccgtggcccatgccaaaaaacttgtggcagagggcgcagat
atcatcgacgtgggtggggaatccacccgaccaggtgctactcgagtgagcgaagaagta
gagctcgctcgagttattcctgtcattacagctctgcacgctgaaggaattaaaacatcg
gtggacaccatgcgagcctcagttgcggctgccgccgctgaggccggggcgggcttgctt
aatgacgtctccggtggccttgcagacaaaaatatgtattcagttatggctgataccgag
cttccggtgtgcctgatgcattggaagacaacaacctttggagatgcctcaggagcgcac
cataccgatgtggtgcgcgatgtccgtgaaggcttgaacgtgctcgttgacaatgccctt
gccgctggtgttgacgcgcaagctattgctattgacccaggtctcggttttgctaaaact
gcagaggacaattgggccttgctcaatgcccttccagaatttatgagcaactatccggtg
ttgctgggggcgtcgagaaagcgctttttagctagcctaggcgtagacacagacgctgct
actgccgcagtcaccgcaatcgctgctcatcatggagtgtggtgcgtccgggtgcacaat
gtggcgctatcccgtgctgccgtagatgttgcggcgaaatggaggaatcatggatcgcat
tga

DBGET integrated database retrieval system