KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_1922Help
Entry
CpP54B96_1922     CDS       T01771                                 

Gene name
adhA
Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
cpp00010  Glycolysis / Gluconeogenesis
cpp00071  Fatty acid degradation
cpp00350  Tyrosine metabolism
cpp00625  Chloroalkane and chloroalkene degradation
cpp00626  Naphthalene degradation
cpp01100  Metabolic pathways
cpp01110  Biosynthesis of secondary metabolites
cpp01120  Microbial metabolism in diverse environments
cpp01130  Biosynthesis of antibiotics
cpp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpP54B96_1922 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    CpP54B96_1922 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CpP54B96_1922 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CpP54B96_1922 (adhA)
   00626 Naphthalene degradation
    CpP54B96_1922 (adhA)
Enzymes [BR:cpp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CpP54B96_1922 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C adh_short Methyltransf_25 TrkA_N Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AFF23039
Position
complement(2073684..2074721)
Genome map
AA seq 345 aa AA seqDB search
MKTDFPEAFTAAVVDNFGPELNIHDVVLPEPGPNQALVKLVASGICHTDLHAAEGDWPVK
PEPPFVPGHEGVGEVVKLGPGHHRVQLGDMVGNVWLWSACGECEYCRTGRETLCNDAEYG
GYTVDGSFGEYMLVDTRYCARIPEGSDPVEVAPILCAGVTVYKGLKETECKPGQYMVISG
IGGLGHIAVQYAVAMGMRVIAVDIADEKLELARKHGAEFAVNALKEDPVESINAFTSGGA
HGVLVTAVHPQAFGQAIGMARKGGTIVFNGLPPGEFPAPIFEIVFKGLTIRGSLVGTRQD
LEEALDFYARGMIKPTVTECKLGDVNSVFADMHKGTVDGRMAIRY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaccgatttccctgaggccttcaccgccgctgtagttgacaactttggccctgaa
ctcaatatccacgatgttgttttgcccgagccgggacctaatcaggcattggtaaagctg
gtggcctctggtatttgccatacagatcttcatgcggcggaaggggactggccggtaaaa
ccggaaccgccttttgtccccgggcatgaaggcgtgggggaagttgtgaaattgggaccc
ggccatcatcgcgtgcaacttggagacatggtgggcaacgtttggctttggtccgcctgt
ggggagtgcgagtactgccgcaccggacgtgaaaccctttgcaatgacgccgaatatggc
ggctatacggtcgacggctcttttggtgaatacatgctggtagatacccgctactgtgcg
cgtattccagaaggctccgatccagttgaagtggcccccatcttgtgtgccggcgtgacc
gtgtacaaaggcctcaaagaaaccgagtgtaagccgggccagtacatggtgatttccggc
atcggtggcctagggcatatcgctgtgcagtatgcggtggctatgggaatgcgagtgatc
gctgtggatattgcagatgagaagctcgagctggcgcgtaagcacggtgcagaatttgca
gtcaatgcgttgaaggaagacccggttgagtcgatcaacgcatttacctcaggtggtgcg
catggcgttttggtcactgccgtgcacccgcaggcgtttggacaagccatcgggatggcc
agaaaaggcggaaccatcgtatttaatgggcttcctccaggagagttcccggcaccgatt
tttgagattgtgttcaaggggttaactattcgcggttcattggtgggaacgcgccaggac
ctagaagaagccctggatttctatgcacgcggaatgatcaaaccgaccgttacggaatgc
aagcttggcgacgtcaacagtgtcttcgccgatatgcataaaggcacggttgatggtcgc
atggctattaggtattaa

DBGET integrated database retrieval system