KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_2022Help
Entry
CpP54B96_2022     CDS       T01771                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cpp00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2203111..2204412
Genome map
AA seq 433 aa AA seqDB search
MEGDTVAEKFDAVDVIRTKRDNGKLSKGQIDWIIDAYTRGIVGDDQMAALNMAIFLNGMD
REEIVQWTQAMIDSGETMSFASLSRPTTDKHSTGGVGDKITLPLAPLVASYGVAVPQLSG
RGLGHTGGTLDKLEAIPGWEADIDNARMMKILEDPGCVVCAAGAGLAPADKKIYALRDIT
ATVDCIPLIASSIMSKKIAEGTANLVLDVKVGSGAFMKELDQARELARTMVDLGRDARTN
MVALLTDMSVPLGRTIGNALEVRESVEVLAGGGPSDVIELTCALATEMLELAGVHDPDVH
EALADGRAMDSWKKMIRAQGGDPDAALPTARHTHEVTADRDGYLTEMDALALGVASWRLG
AGRARKEDPVQLGAGIEIHAELGEKVSKGQKLFTLHTDDEDRFSRALESLEPGVNIGDEP
PAPRPSVILDRIS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtgataccgtggccgagaaattcgacgccgtagacgtcatccgcacaaagcgg
gacaacgggaagctaagcaagggacaaatcgactggatcatcgatgcctacactcgcggc
attgttggcgacgatcaaatggctgccctcaacatggcaatattcctcaacggcatggac
agagaagaaatcgtccagtggacccaggccatgatcgactccggcgagaccatgagcttt
gccagcctctcccggccaacaacagacaagcactccaccggcggggtcggcgataaaatc
acgcttccacttgcgccactcgttgccagttacggcgttgctgtgccacaactctctggt
agaggactaggacacacaggcggaaccctagacaaattagaggccatccccgggtgggaa
gctgacatagataatgcccgaatgatgaagatcctcgaagaccccggctgcgtggtatgc
gccgcgggagcaggcctcgcacccgccgacaagaagatctatgcgctgcgtgacatcact
gccaccgtcgactgcatcccactgatcgccagctccatcatgagtaaaaaaatcgccgag
ggaaccgcaaacctagtcctcgacgtcaaggtgggttccggggcctttatgaaggagctt
gaccaggcccgcgagctcgcccgcacaatggttgacctaggccgcgacgccagaaccaat
atggtcgcgcttctcaccgacatgtccgtccccctggggcgcaccatcggcaatgcccta
gaagttcgcgagtctgtagaggtcctcgcaggtggcggcccttccgacgtcatagagctc
acatgcgcccttgcgacggagatgcttgagctcgccggcgtccatgatcccgatgtccac
gaagcgcttgccgacggccgcgcgatggactcttggaagaagatgatccgcgcacagggc
ggcgaccccgacgcagcactccccaccgcacggcacacccatgaggtcaccgccgatcgc
gacggctatctcacagagatggacgccctcgcactgggagtagccagctggcgactcggc
gcaggacgcgcacgcaaggaagatccagtccaactcggcgcaggcatcgagatccatgca
gagctcggcgagaaggtatcaaagggccagaagcttttcaccctccacaccgacgatgag
gaccgtttcagccgagccctagaatccctcgaacccggcgtaaatatcggcgatgagccc
ccggcacctcgcccctcggtcatccttgatcgcatcagctaa

DBGET integrated database retrieval system