KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_2120Help
Entry
CpP54B96_2120     CDS       T01771                                 

Gene name
trpC
Definition
Bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CpP54B96_2120 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CpP54B96_2120 (trpC)
Enzymes [BR:cpp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CpP54B96_2120 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CpP54B96_2120 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2310128..2311393
Genome map
AA seq 421 aa AA seqDB search
MECKSASPSLGTIRTDYSPGDIARIYSRYASAISVLCEPDKFNGDYDHLATVAASTHLPV
LCKDFIVDPVQVQAARYFGADAVLLMLSVLDDATYLSLSSEAERLGLDVLTEVINEEEVK
RGIRLGAKIFGVNHRNLHDLSIDLSRSSQLEPLIPENAVLVSESGIKTNETVRQLAGHSD
AFLVGSQLTSHSNIDSASRSLVYGTNKVCGLTTASAAQNARAVGATHGGLIFEDSSPRNV
SRETAEKIIAAEPNLNYVAVSRRDHGWEEILLPEITSLQIHAPYQGSIAGERALIDNARR
ELQKAGREDVSIWRAVSMTLPEGAATATALTDDVDMLLLDAGIGGTGTSFNWEKITPDIA
PKAILAGGLNLDNLPEALKAGCAGLDLNSGFEYPSTAGSWSGMKDSGLLRQAFSKIRNFH
Y
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggaatgcaaatctgcatcaccatcattaggcacaatccgtaccgactattccccggga
gatattgcacgcatttattctcgatatgcttctgcaatttccgttctttgtgaacccgac
aagttcaacggcgactacgaccacttggccactgtcgcggcttccacgcatttgccggtc
ttatgcaaggactttatcgtcgaccctgtgcaggttcaggctgctcgttactttggcgcg
gacgcggtcttgctcatgcttagcgtgcttgacgacgccacctacctctcactttctagc
gaagccgaacgtctcggactcgatgtgctcaccgaagtaataaacgaagaagaagtaaaa
aggggtattcgtctcggggctaagatatttggcgttaatcaccgcaacctacacgatctc
agcatcgacctttcccgctcctcacagctagagcctctcattccagaaaacgccgtatta
gtatcagaatctggcatcaaaacaaatgagaccgttagacaactagctggacattccgac
gctttccttgtgggctcccagctcaccagccacagcaacattgactccgcctcccgttca
ctcgtttacggaaccaataaggtatgcggtctcaccacggcttccgcagcgcagaatgct
cgcgcagttggcgcaacacacggggggctaatttttgaagactctagcccccgcaatgtt
tcacgtgaaaccgccgaaaaaatcattgcagcggagcccaacctgaactacgttgcagtg
agcagacgcgaccatggatgggaggaaatacttcttccagaaattacgagtctccaaatc
catgccccataccagggatccatagcaggggagagggcgctcatcgataatgcccgtcgg
gagcttcaaaaagcgggaagggaagatgtctccatctggagagctgtgtccatgacactt
ccagagggagccgccaccgctaccgcactgacggatgacgtagatatgttgcttctcgac
gccggcattggaggcaccggaacatcgtttaattgggaaaaaatcacgccagatatagcc
cctaaagcgatcctggcaggaggtcttaacctcgacaatcttcctgaagctttaaaggca
ggatgtgccggcctggatctcaattctggtttcgagtacccatccaccgctgggtcatgg
tctgggatgaaagattccggattgctacggcaagcgttctccaagatccggaattttcat
tattag

DBGET integrated database retrieval system