KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_2121Help
Entry
CpP54B96_2121     CDS       T01771                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
cpp00260  Glycine, serine and threonine metabolism
cpp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpp01100  Metabolic pathways
cpp01110  Biosynthesis of secondary metabolites
cpp01130  Biosynthesis of antibiotics
cpp01230  Biosynthesis of amino acids
Module
cpp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CpP54B96_2121 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CpP54B96_2121 (trpB)
Enzymes [BR:cpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CpP54B96_2121 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFF23227
Position
2311789..2313039
Genome map
AA seq 416 aa AA seqDB search
MTLSYNKTTQQTLLPAYFGEFGGQFVPESLLPALDQLEKAFVEAQEDPHFHKELAGYLKD
YLGRPTPLTECSKLPLQGKGKGYARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKKRII
AETGAGQHGTATALACALLNLECVIYMGAKDVERQQPNVYRMELMGATVVSVDSGSGTLK
DAVNEALRDWTATFHESHYLLGTAAGPHPFPTIVREFHRVISEEAKAQMLERTGGLPDVV
VACVGGGSNAIGMFADFIEDASVELVGAEPGGEGLSSGKHGATINNGRIGILHGAKSYLM
RNSDGQVEESYSISAGLDYPGVGPQHAHLSQSGRATYVAITDAEALEAFQLLSREEGIIP
ALESSHALAYALKRAALAEDEGKNITILVSLSGRGDKDIDHIRKTLAANPELSLKD
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacactttcttacaacaaaaccactcagcaaacactccttcctgcatactttggggag
ttcggcggacagtttgtccccgagtcactccttccagcgcttgatcagcttgaaaaagct
tttgtcgaggcccaagaagacccacactttcacaaagaactagcgggctatctcaaagac
tatttgggaagaccaactccattaacggaatgctccaagctacctttacagggaaaaggt
aagggatatgcgcgcatcttccttaaacgcgaagaccttgttcacggtggagcacataaa
acaaaccaagttatcggccaggctcttttagctaagaggatgggtaaaaagcgcatcatc
gcagaaactggtgccgggcaacatgggacagcaaccgcccttgcatgcgcacttttaaac
ctcgaatgcgtcatttacatgggagctaaagacgtggaacgtcaacagcccaatgtgtat
cgcatggagcttatgggagctactgtggtgtccgtagattcaggttccgggacactcaaa
gatgcggttaatgaggccctgcgcgattggaccgcaacgttccacgaatcccattatctg
ctcggtacggcagccggacctcatccgtttcccacgatcgtccgagaatttcatcgtgtc
atttcagaggaagctaaagcacagatgcttgagcgcaccggcggactcccggatgttgtg
gttgcttgcgtgggcggaggctccaacgcaataggtatgtttgcagacttcattgaggat
gcatctgtagaactcgttggtgcggaacccggcggtgagggattatcgtccggaaagcac
ggtgcaaccattaacaatggacgtatcggtatcctgcacggcgccaaaagctatttgatg
cgaaattctgatggtcaagtggaagaatcctattccatttccgccgggctggattatccc
ggagtcggtccacagcacgcgcacctatcacagtctgggcgagccacctatgtggccatc
acagatgccgaggcgcttgaagccttccaattactttcccgtgaagagggaatcattcca
gcattagagtccagccacgccctcgcatatgcgttgaaaagagctgccctcgcggaggat
gagggtaagaatatcaccatattggtctccctttcagggcgtggcgataaagacatcgat
cacattcgcaagactctagctgccaaccccgagctttccctcaaggactaa

DBGET integrated database retrieval system