KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0031Help
Entry
CpC231_0031       CDS       T01877                                 

Gene name
pknB
Definition
(GenBank) Serine/threonine-protein kinase
  KO
K12132  
eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Brite
Enzymes [BR:cpq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CpC231_0031 (pknB)
Protein kinases [BR:cpq01001]
 Serine/threonine protein kinases: Other group
  Bacterial family
   CpC231_0031 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(29629..31623)
Genome map
AA seq 664 aa AA seqDB search
MNDVIAGRYELGEVIGTGGMSEVYSATDTLLGREVAIKMLRADLARDVNFRERFRREAQN
SGKLNHPAIVAVYDTGETERAGISTPYIVMERVHGRTLRDIVREDGPLSPTEAAQTLLPV
CQALQFSHDAGIIHRDIKPANVMITNTGAVKIMDFGIARALDDATSAMTQTSAVIGTAQY
LSPEQARGKLADARSDVYALGCVLYETLTGRPPFEGETPFAVAYQHVQEDPAKPSEFVSD
LTPTAAVNVDAVVLTAMAKHPGDRYQTAMEMGADLERLARHAVTEAARHYVSPASLISQE
PNPTTIVPVTQLDQPEADPVTSRAERAGYERSAFAGPAHAAEEDRSGMSKAMKAVLAVLA
VLVLGVGGAFAYDYVSNSSKNRSLVNIPKLEKTSQQDAVNQLEQLGLQVNVIEEANPEVP
RGKVIRTNPTSGSSVQKNTTVTVIVSSGKEVTEVPDLARKNTADAAKILEEAGLQLDSTV
REESSDSVPNGEIIEQTPSAGSQVSRGSKVVITVSTGVQNVRVPVVTGMKWDQAEGNLTS
LGFVPDVRTVDAPEPAGTVVAVSGEGTEVPKGSTITVKVSNGQMFNVPNITRLTVADAVR
ALNAAGWTGTASKLTQGERVPTVSLSDQNLIASQVPAAGTPLRKDSPIEIHLYEFSLSAL
TGTR
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatgtgattgctggccgctatgagcttggtgaggtcatcggcacgggtggaatg
tcagaggtctactctgccaccgatactctccttggccgcgaagtcgccataaagatgctg
cgtgcagaccttgcccgcgatgtgaatttccgcgagcggtttcgcagagaagcccaaaac
tccggcaagctgaatcacccagcgattgttgcggtgtatgacactggcgagaccgaacga
gcgggcatcagcactccttacatcgtgatggaacgggtgcacggtcgaaccctccgggat
atcgtgcgagaagacggcccactttccccaacagaagccgcacaaacgttgcttccggta
tgccaagcgctgcagtttagccacgacgccgggatcattcaccgcgacattaaacccgca
aacgtgatgatcactaatacgggcgcggtaaaaattatggactttggcatcgcccgcgcg
cttgacgacgccaccagcgccatgacgcagacctccgcagtgatcggcaccgcccagtat
ctctcccctgagcaagcccgaggcaagcttgccgacgcccgctccgatgtctacgccctg
ggctgcgtactttatgagacccttaccgggcgtcctccctttgaaggagaaacacccttc
gccgtcgcctatcagcatgtccaagaggacccggccaagcccagtgaatttgtttccgat
ctcacccctactgctgcggtgaacgtcgatgccgtagtcctcacagcgatggccaagcac
cctggtgatcgctaccaaacggctatggaaatgggtgcggatcttgaacgtctagctcgg
catgctgtgacagaagctgctcgccattacgtttcacctgccagcttgatcagccaagag
cctaaccccaccactatcgttcccgtcactcagctagatcagccggaagcggatccggtc
acgtcgcgagcagaaagagccggatatgagcgctctgcttttgctggcccggctcatgcc
gcggaagaagatcgatccggcatgagcaaagcaatgaaggcggttcttgcggttcttgca
gtgctggtgctcggcgtaggcggcgcttttgcctacgattatgtgagcaacagcagcaaa
aatagatcattagtcaatattcccaagttggaaaagacgtctcagcaagatgcagtgaac
cagctagagcagctgggtctccaggtcaatgtgatcgaagaggctaaccccgaggtgcca
cgggggaaagtcatcagaaccaaccccacaagcggttcctcagtacaaaaaaacaccact
gttacagtgattgtttcttctggcaaggaagtcactgaggtccctgatcttgcgcgcaag
aataccgcagatgcagcgaagattcttgaagaagccggattgcagttggattcaactgtt
cgtgaagaaagctcagatagcgttcctaatggagaaatcatagagcaaactccaagcgct
ggctcgcaagtttcccgaggctcaaaggtggtcatcaccgtatctactggagtgcaaaat
gttcgtgttccggtggtgacaggaatgaagtgggaccaggcagaaggcaatctcacgtca
ctgggatttgtacccgatgtacgtactgtggatgctcccgaaccagccggtaccgttgtt
gccgtctctggcgagggaactgaagtgcctaagggatcaacaatcacggtcaaggtatcc
aacggccaaatgtttaacgtccccaacatcactcggcttaccgttgctgatgccgtaagg
gcgcttaatgctgcaggttggacgggtactgcttctaagctcactcagggagaacgcgta
cccacggtatctttgtccgatcagaatttgatcgcttcccaggttccggccgccggcacc
ccactacgcaaagattcaccaatagaaattcatctctatgaattcagcctctcagctctt
actggcactcgctag

DBGET integrated database retrieval system