KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0035Help
Entry
CpC231_0035       CDS       T01877                                 

Gene name
pstP
Definition
(GenBank) PP2C-family Ser/Thr phosphatase
  KO
K20074  
PPM family protein phosphatase [EC:3.1.3.16]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Brite
Enzymes [BR:cpq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CpC231_0035 (pstP)
Protein phosphatases and associated proteins [BR:cpq01009]
 Protein Ser/ Thr phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    CpC231_0035 (pstP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(35979..37490)
Genome map
AA seq 503 aa AA seqDB search
MLRLNYAVASDRGLVRGNNEDSAYAGPHLIALADGMGGHAAGEVASQLMIKHLMPLDASP
DDNDMLALLASGADDANRAIAQGVRDEPATNGMGTTLTAIMFNGTDLAMCHVGDSRGYRY
RDGELEQITVDDTYVQSLVDKGELSPEDVSTHPQRSMILKAYTGRPVEPTLTMLEARAGD
RLLLCSDGLSDPVTHSTIETAIAQGTPAEVARKLVDLALRSGGPDNVTVVVADIVEGPSD
DQELPVVPVTAGALNGEQPEDPRPDTSAGRAAIVMAARQPQTIPARDAHTVTADQANAVN
TNEPPTDGEKKSGRGKFWAGIITLLVIAAAIAGGWWAKTMVDNNYYVTTANEEGLENAIV
IERGVDLEFFGKPLHSTYQYACLNSSGDLSLIPENSHDTCHRFRLKDLTESARSSVASLP
EGNYNDVQQQVQQLANQLLPVCVTREAVTKPDEKKPEDQAPNGAPPQAEANPAAPQEQEG
ASPSKKPEPGDLSTPGVTCREVK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctcagacttaattatgcggtggcctccgatagaggcctcgtgcgcgggaataacgag
gactctgcatacgcgggtcctcacctcattgcgcttgccgacggcatgggcggtcacgca
gcgggtgaggtggcatcgcagctgatgatcaagcacctcatgccgctcgacgccagcccc
gacgacaacgatatgctcgcgctgcttgcatcgggcgccgacgacgctaaccgggcgatc
gcgcagggcgtgcgggatgaaccggccaccaacggcatgggcaccacgctcaccgcaatc
atgttcaacggcaccgacctggcaatgtgccacgttggcgattcccgcggctaccgctat
cgcgatggcgaacttgaacaaatcactgtggatgacacctatgtgcagtcactagtagat
aaaggcgagctctcccctgaagacgtctccacgcatccgcagcgttctatgattttgaag
gcctacactggccgccccgttgagcctacgctcaccatgctagaagcccgtgctggcgat
cggctgttgctatgttccgacggactctctgacccagtaacgcactcgaccatagaaact
gctattgcccaagggactcccgccgaggtggcccgcaagctcgtggacctagcgctgcgt
tctggtggcccggataacgtcaccgtagtggtcgctgacatcgtggaaggccccagtgac
gaccaagagctccctgtagtccccgtaacagcaggggcattgaacggagaacaaccagag
gatccccgtcccgatacctcagcgggtcgggctgccatagtgatggcggcacgccagcca
cagactatcccggcgcgcgatgcacacacggttacagcagatcaggctaatgccgtcaac
actaacgagccccccaccgatggtgagaagaaaagcggacgcggtaaattttgggcgggc
atcatcacacttcttgtgattgctgcagccatagccggtggctggtgggcaaaaaccatg
gtagataacaattattacgtgaccactgccaatgaagaaggtctagaaaacgcgatcgtg
attgaacgcggcgtggatcttgaattctttggtaagccactacattccacttaccaatat
gcctgcctgaattccagtggcgatctctcccttattcctgagaattctcacgatacttgc
caccgcttccggctcaaagacctcaccgagtctgcacgtagttccgtcgctagcctgccg
gaaggcaactacaacgacgtacagcagcaagtgcagcagttagccaatcagctgctgccg
gtatgcgtcacccgcgaggctgtgactaaaccggacgagaagaagcccgaagaccaagca
cctaatggtgcaccccctcaagcggaagcaaaccccgctgctcctcaggagcaggagggg
gcgtcgccaagcaaaaagccggagccgggtgatctctccactcccggagtgacttgtaga
gaggtgaagtaa

DBGET integrated database retrieval system