KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0040Help
Entry
CpC231_0040       CDS       T01877                                 

Gene name
padR
Definition
(GenBank) Transcription regulator padR
Organism
cpq  Corynebacterium pseudotuberculosis C231
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PadR FUR DUF505 Replic_Relax DUF4364 DUF1495 HTH_34
Motif
Other DBs
NCBI-ProteinID: ADL09539
UniProt: D9QD95
Position
complement(41034..41357)
Genome map
AA seq 107 aa AA seqDB search
MARSSGFDNGNLSDAAVHILLALIEPRHGYAVMQFLHDASHGHIDIGPASLYTTLKKLTA
ANLITEVDTDENRRIYHITPHGHEVLTDNLERRRQLITMVDSILETS
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcagttcaggatttgataacggcaatctcagcgacgccgccgttcatatcctc
ttagccctcatcgaacctcgccatggctacgcagtaatgcagtttcttcacgacgcaagc
cacggacatatcgacatcggcccagcctcgttgtacaccacgctgaaaaaactcaccgca
gccaatctgatcactgaggtagataccgacgagaaccgccgcatttaccacatcaccccc
cacgggcacgaggttctcacagacaatctcgaacgccgccgccaactcatcaccatggtc
gactcaattctggagacatcatga

DBGET integrated database retrieval system