KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0049Help
Entry
CpC231_0049       CDS       T01877                                 

Gene name
cskE
Definition
(GenBank) Anti-sigma factor
Organism
cpq  Corynebacterium pseudotuberculosis C231
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(50995..51639)
Genome map
AA seq 214 aa AA seqDB search
MTPTGHSEPFDDFPHDVEALLAQAPAPIIPSAQLRDNILDAIADIPQEEPEATHAPPIDV
PAEPIADVIPLSGRRKFTRGFLAVAASVAIIAGGFAFWPQADPHAEMHSILAASDVRQAN
THAMGASLDIVVSSSMNEGGALVDGAPKLSEGMGAQVWAVMADGSTKSAGVIGPEDHDGV
WMPLPGETSKVMITEEPLKGSSQPQGTVLAVVDV
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgacccccacaggacacagcgaacctttcgacgatttcccacacgatgtcgaagccctg
ttggcgcaggcacctgcaccaataatcccctcggcgcaattacgagacaacatcctcgat
gccattgccgatattccccaagaggaaccagaagcaacgcatgcgccgccgatcgatgtc
ccagctgagcctattgcggatgttattccgctatctgggcgccgtaagtttacgcgtggg
tttcttgccgtggcggcgtcggtagccataatcgctggcggctttgcattttggccacaa
gcagacccgcatgcagaaatgcacagtattctagcggcttctgatgtacgccaggccaac
actcatgccatgggcgcatcactggacattgttgtgtcctcgtcaatgaatgagggcggc
gcgcttgttgatggtgcacccaaactcagcgaaggcatgggcgcacaggtatgggcagtg
atggcagacggctccacaaaatccgccggcgttatcggacccgaggatcacgatggagta
tggatgccattaccaggggaaacctcaaaggtgatgattactgaggagccactcaagggc
agctctcagccacagggcacagtccttgccgtagtagatgtgtaa

DBGET integrated database retrieval system