KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0055Help
Entry
CpC231_0055       CDS       T01877                                 

Gene name
opuBD
Definition
(GenBank) Choline transport system permease protein opuBD
  KO
K05846  
osmoprotectant transport system permease protein
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
ABC transporters
Module
Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:cpq00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CpC231_0055 (opuBD)
Transporters [BR:cpq02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    CpC231_0055 (opuBD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(56064..56702)
Genome map
AA seq 212 aa AA seqDB search
MRWLRHAWPYVLDMAAAHLFLSIPAILISIAVSIPIGMFAARNPRVGNLVVSAASLAYTI
PALPMLILVPFIVGVPLRSDTNVIIALCIYGVALLARTATDAFRSIPEDVRMSASAQGMS
APQVALKVDLPLAIPVLISGIRVLGVSTIGLVTIGALIGVSSLGTLFTDGFQRNITAEVL
TGIGAVVILAVLFDVLCLILQRVLAPWSVIKK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggctacgtcatgcgtggccatatgtgctggatatggcagcagcccatctcttc
ctcagtattccagcaatccttattagtatcgcggtctccatccccatcggcatgtttgcc
gcccgcaatccgcgcgtaggaaacctagtggtatccgcggcctccctggcttatacaatc
cccgcccttcctatgctgatattggttcctttcatcgtgggagtacccctgcgatcagat
actaacgtcattatcgcgctatgcatctatggagtcgctcttcttgcacgtactgcaaca
gatgcttttcgttccatacctgaggacgtgcgcatgtccgcatctgcccaaggcatgagt
gcgccccaggttgcgttaaaggttgatctgcctcttgctattccggtattaatctccggc
attcgcgtgctcggtgtctccactattggcctggtgaccatcggcgcattaataggagtg
tctagcctgggaacactgtttactgatggttttcaacgcaatattactgctgaggtactc
actggtataggtgctgtagtcatactcgcggtgcttttcgacgtcctctgtctcatcctt
caacgcgtactcgcaccttggtcggtgataaagaaatga

DBGET integrated database retrieval system