KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0057Help
Entry
CpC231_0057       CDS       T01877                                 

Definition
(GenBank) Hypothetical protein
Organism
cpq  Corynebacterium pseudotuberculosis C231
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(57943..58143)
Genome map
AA seq 66 aa AA seqDB search
MITAPQRKENLMDILNKAKELLDQNADKVKDAVEKVGDLVDEKTDGKFADKVDQVQEAVK
KKLDEK
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
gtgataactgcccctcaacgcaaggagaatctcatggacatcctcaacaaggctaaagaa
ctgctagatcaaaacgccgacaaggtaaaggatgcggtagaaaaagttggcgatcttgtc
gacgagaaaaccgacggcaagtttgcagacaaagtcgaccaggtccaagaggccgtaaag
aagaaattagacgaaaagtaa

DBGET integrated database retrieval system