KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0062Help
Entry
CpC231_0062       CDS       T01877                                 

Gene name
amn
Definition
(GenBank) AMP nucleosidase
  KO
K01241  
AMP nucleosidase [EC:3.2.2.4]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:cpq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CpC231_0062 (amn)
Enzymes [BR:cpq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.4  AMP nucleosidase
     CpC231_0062 (amn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
61532..62947
Genome map
AA seq 471 aa AA seqDB search
MAMKKGVGADVVQQLEEIYAASISLAKEILETGEYGRYCDVVYPKLIVKILSWHPVDRTE
PFGYVDAAGCYSAVLSKPELIHDYLCEQLERLCANYECVITVEPSTVRIPPEYIDGIEGV
TEARRAGDVAAEIPRPTLDDVDDAIIDGEWDAFHGEEKPLFHFTPQRFDIACARIQHYTG
ISPASVQKYILFTNYSMHAREFVNFGLCELSREGSRYSALVLPDGHKITRDQAEHIDRES
LSLESRFQMPRYDLVAEDGMGITMINIGVGPSNAKTITDCLAVLRPEAWVMIGHCAGLDG
RMRIGDLILGNAYQRDDHLLDDHIPLDLPIPAVPEVQRALEASVREVYGEDLSLMRTGTV
LSTDDRNWEWHTPQKLWKLLRGSTAAACDMESATLAANGYRYRIPYGTLLSVSDLPLHAV
PKLPAAAQTFYANSKQAHVMCAVHAMELLALTPEKLRTRKLRRTIGEVPFR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtggcaatgaaaaaaggcgtgggtgcggacgtagtacaacagttggaggagatctacgcg
gcgtcgataagccttgccaaggagatcctagagactggcgagtacgggcgctactgcgat
gtagtttatcccaagctcatagtgaagatccttagctggcaccccgttgatcgcaccgag
ccttttggttatgtggacgctgcaggatgctactcggcggtgctctctaagccggagttg
atccatgattacctttgtgaacagctggaacgtctctgtgcaaattatgaatgcgtgatt
accgtggaaccttccacagtgcgcattccaccggagtatatagacggaatagaaggcgta
accgaggctcgtcgtgcaggtgatgtagctgccgaaatcccacgacctaccttggatgac
gttgatgatgccattatcgacggcgaatgggatgccttccacggcgaggaaaaaccgctc
ttccatttcaccccgcagcgttttgatattgcgtgtgcgcgcatccagcattacaccgga
atttccccagctagcgtgcaaaaatacatactttttacaaactattccatgcatgctcgg
gaatttgtgaactttgggctatgcgagctgtcgcgggaaggatcgcgttacagcgcattg
gtgcttcccgacggccacaagatcacgcgcgaccaggcggagcatattgatcgggaaagc
ctgagcctggaatccaggttccaaatgccgcgctatgacctagtggcggaagacggaatg
ggcatcaccatgatcaatatcggtgtgggaccgtccaatgccaagacgattacggactgc
cttgctgtgcttcgaccggaagcgtgggtgatgatcgggcattgcgctggacttgacggc
cgcatgcggatcggtgaccttattctggggaacgcctaccagcgcgatgaccacctcctt
gacgaccatattcctcttgatctgcctatacccgcagttccagaggttcagcgtgccctg
gaagcgagtgttcgggaggtatatggcgaggatctttccttgatgcgtaccggcaccgtc
ctctccaccgacgaccgcaactgggaatggcacaccccgcaaaaactatggaaactactc
cgaggctctactgcagctgcctgtgacatggaatcggcaacgctagcggctaatggatac
cgctatcgcattccttatggcaccttgctttccgtttctgaccttccgcttcatgccgtt
cctaaactgccggctgcagcgcaaaccttctatgcaaattccaagcaggcgcatgtgatg
tgtgcggtacatgccatggagcttcttgctcttactccggaaaaactgcggacgaggaag
ttacgccgtacgatcggggaggtgccattcagataa

DBGET integrated database retrieval system