KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0063Help
Entry
CpC231_0063       CDS       T01877                                 

Definition
(GenBank) Hypothetical protein
Organism
cpq  Corynebacterium pseudotuberculosis C231
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADL09562
UniProt: D9QDI9
Position
63024..64448
Genome map
AA seq 474 aa AA seqDB search
MRKLTMAILCSTALALGACGSMGKAGGPSNALSIEQTTQIDSADGIDASKLLFSSSQAVV
IAGDSVGQKWEGAKAAVKRGAPLLVRTADNASAIDSEIKRLGAQDVIKIDEPQAPDPEIS
EANIADKISQLTPESPLFNGGASILVSGHTTAADVATARASGANVEYLSSGDARESSALS
ADPDAHVVALGPSFANKERFNRQVEMISHGEVPGGGHLIFPSHRVVALYGHPSGGALGVL
GEQPAEEAVNRVNDLVGKYQAIAPEESMIPAFEIIATVASSSAGPDGNYSNEGNVDELRP
WVEAIGDAGGIAILDLQPGSASFLEQAQQFEELLKLPHVGLAIDPEWRLKPGEKPMERVG
SVGAGEVNQTAAWLRDLVKDNELPQKVFVVHQFQHQMVQNRETLDTTAPELSWVLHADGH
GTAGDKFATWDMVRKNLQPEFYLAWKNFIDEDQPMFTPEQTFKIEPRPWFVSYQ
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
ttgcgaaagctaacaatggccatactttgcagtactgcattggctctgggcgcatgcgga
agtatggggaaagcgggcggcccgagcaatgcgttgtctatagaacaaacaacgcagata
gacagcgcagacgggattgatgcctccaaactgctcttttcctcttcccaagccgttgtt
atcgccggtgattctgtggggcagaagtgggagggcgcgaaagcagcggtgaagcggggc
gcgccgctgctggtgcgcactgccgataacgcgtcggccattgattcggagataaagcgc
ctcggggctcaagacgttattaagattgacgagcctcaggccccggacccggaaatttcc
gaggccaacattgccgataaaatctcgcagctcacgcccgaatccccgctttttaacggc
ggcgcgtccatcctggtctccgggcacaccacggccgctgatgtagccaccgcacgcgcg
tcgggggccaatgtggagtacctgtcttcgggcgatgcgcgtgaaagctctgcgctatcc
gctgatcccgacgctcatgtggttgccctgggtccaagttttgccaacaaagaacgcttt
aatcgccaggtagagatgattagccatggtgaggtccccggtggcgggcatctcattttc
ccctcgcatcgcgtggtagctctctacggtcatccttccggcggggcgctgggagtgctt
ggcgagcaacctgctgaggaagccgtaaacagggtgaatgatttagtgggtaagtatcag
gccattgcaccggaagagagcatgatccccgcctttgagatcattgctaccgtggcgagc
tcgtcagcagggccggatggcaattattccaatgaggggaacgttgatgagctgcgcccg
tgggttgaagcgattggtgatgctggaggcatagcgattcttgatctacaacctggcagc
gcaagcttccttgaacaggcacaacaatttgaggaattgctgaaactaccgcacgtcgga
ctggcgatagatcccgagtggcggcttaagccgggggagaaacccatggagagggtcggc
agtgttggggcgggggaagtgaaccagactgctgcgtggctgcgggacctggtaaaagat
aacgagctcccgcagaaagtctttgttgtgcaccaatttcagcatcagatggtgcagaac
agggaaaccttggacaccacggcaccggaactttcgtgggttcttcacgcagatggccac
ggaaccgcgggcgataagtttgccacgtgggatatggtgcggaagaatctgcagcccgag
ttctaccttgcgtggaagaactttatcgatgaggatcagccgatgttcacccccgagcag
acgtttaagatcgagcctcggccttggtttgtgtcctatcaataa

DBGET integrated database retrieval system