KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0064Help
Entry
CpC231_0064       CDS       T01877                                 

Definition
(GenBank) Lysozyme M1
Organism
cpq  Corynebacterium pseudotuberculosis C231
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
64754..65923
Genome map
AA seq 389 aa AA seqDB search
MTSEIIGRVAIMMKTRRLKTALCTVLASSTFAVASVQAIPLPFPLGASSGIDVSGHQHPN
SSSINWKDVKSHGQSFAFVKATEGLGWTNDFYASDITQAAAQGLKVGSYHYARPGADARQ
QARHYANVISHTPNHSLPPVLDLEVAEGKTPQELVNWTRDFVQELEKQTGRVPMIYTYRY
FWIEQMANTTEFSQYPLWLAAYQAQVPGTVGGWDQIDFWQRSSSGRINGIVGDVDMNLFN
GDDGELAAFAAGNLHAAGNKFASINLPELADLGKNAGGVVAVILALSAGAAAAPQLIQAA
EAAGLSSEGAQDLTTVLQALAKAGKLPVDQLNKMASGNYTVGDLIILLDNAAHIAGLDEG
QSSKAAMRADELNIDANQVAQVLRSLAAR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgactagtgagattattggtagggtggcgatcatgatgaaaacccgtcgtctgaagact
gccctttgcacagttcttgcctcgtccacttttgccgttgcctcggtccaagccattccg
cttccttttccgctcggtgcttcctcaggcatagacgtttcgggccatcagcaccctaac
agcagcagtattaactggaaggacgtaaaatcccacggacagtcctttgcttttgttaaa
gcaacagaggggctgggctggaccaatgacttttatgccagtgacattactcaagccgca
gctcaagggctgaaggtagggtcgtatcactacgcccgtccgggcgctgacgcacggcag
caggcgcgtcactacgccaatgtcatctctcatacgccgaaccattccttgccgcctgtc
ctggatcttgaggtagctgaggggaaaaccccgcaggagctggtcaactggacacgagat
tttgttcaggagctggaaaagcagaccggtcgcgtccccatgatctacacctaccggtac
ttctggattgagcagatggctaacaccactgagttctcgcagtacccactctggcttgcg
gcatatcaggcgcaggtacccgggaccgtgggcggctgggatcagattgatttctggcag
cgctccagctccggacgcattaacggcatcgtcggcgacgtagatatgaacctgtttaac
ggtgacgacggcgaactcgccgcttttgctgcaggtaatctccacgctgcgggcaacaag
ttcgcctcgatcaaccttcccgagctggccgatttgggtaagaacgcagggggcgtagta
gcagttattctggctttgagcgccggagcagctgctgcaccacaactgattcaagccgcc
gaggccgcaggcctaagctccgagggggctcaggacctcaccactgtgttacaagctttg
gccaaggcaggaaaactcccagtggatcagcttaacaagatggctagtggtaattacacc
gttggtgacctgattattctgctggataacgcagcccacattgcgggactggatgaaggc
cagagctctaaagctgcgatgcgcgcagatgagcttaatatcgacgccaaccaggttgca
caggtacttcgcagcctcgccgcccgctaa

DBGET integrated database retrieval system