KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0075Help
Entry
CpC231_0075       CDS       T01877                                 

Gene name
marR
Definition
(GenBank) Multiple antibiotic resistance protein marR
Organism
cpq  Corynebacterium pseudotuberculosis C231
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
76541..76957
Genome map
AA seq 138 aa AA seqDB search
MAKDHALDELICFQLYTASRLMQRIYRPYFDDWGITYPQYLVLVCLWERDGRSIGQLADP
LNLDSGTLSPLLQRMEDNGFVRRKHVTDDFRRLRIFLTAKGKRLKPLADKMQEELVETLR
LDYQDLAAVHDLVNKISP
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagatcatgcacttgatgagctcatctgctttcagttatatacagcatctcgt
ctgatgcagcgtatatatcgcccttatttcgacgactggggtatcacctatccgcagtac
ctggttctcgtctgcttatgggaacgcgatggcagatcgattggtcagcttgcagatcca
ctgaatttggatagcggaaccctgtctcctctgctgcagcgcatggaggataatgggttt
gttcgtcgtaagcatgtaacggatgattttcgaagattacgtatttttcttactgctaaa
ggcaagcggctcaaaccgcttgccgataaaatgcaagaggaactcgtggagacactcagg
cttgattaccaagaccttgcagctgtacacgacctcgtgaacaaaattagcccctaa

DBGET integrated database retrieval system