KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0081Help
Entry
CpC231_0081       CDS       T01877                                 

Gene name
sgaA
Definition
(GenBank) PTS system, IIA component
Organism
cpq  Corynebacterium pseudotuberculosis C231
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
80919..81734
Genome map
AA seq 271 aa AA seqDB search
MPKLNELLADESIELHGKAETWSDAIAKSGALLEKTGAITDEYTRAMIENVEANGPYIVV
APGFAFAHARPSSAVKKTAISWLHLDQPVSFGHSKNDPVHLVVALAAQGDTVHTAAMKDL
AQLLGDKQRKNALDQVKTVEELRAVLEDDLTVNSAVKPAAAVASTADYSAKTQATAPKGK
ILTVCGNGLGTSLFLKNTVEQVLDYWKWSPYFSVEATDTISAKGRAHEADFILTSGEIAA
TLGDLGVPVYVIQNFTSPVEIDSALRQLFDV
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagctcaatgaactgcttgcagatgaatcaatagaactgcatggaaaagcagag
acctggagtgatgccattgccaaatctggtgcccttttagaaaagacaggtgcgataacg
gatgagtacaccagggcaatgatcgaaaatgtggaagccaacggaccgtacattgtggtt
gcgccaggctttgcttttgcgcatgctcgcccgtcctctgcggtgaaaaagactgcgatt
tcttggctgcatttggatcaaccagtttcttttggtcattcgaagaatgaccccgttcac
ctagtggttgctcttgccgcgcagggagacacagtacatactgccgcgatgaaagacttg
gcacagctactgggagacaaacagcgcaagaacgcccttgaccaggtgaagaccgtggag
gaactgcgggcggtcttggaagatgacctgaccgtgaactcggcggttaagcctgcagca
gcggttgcctctacagctgattattctgcaaaaacgcaggcaacagcaccaaaaggaaaa
atactcacggtgtgtgggaacggcctagggacctctttgtttctgaaaaacacagtggaa
caggtgctcgattattggaagtggtccccttatttttcggtcgaagccaccgacacgatt
tccgcaaaagggcgcgctcatgaggcagatttcattttgacttcgggggaaatcgcagcg
accctcggtgatctgggagtgcccgtctacgttatccagaactttacttcaccagtagaa
attgactcagctctacggcagcttttcgacgtctaa

DBGET integrated database retrieval system