KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0086Help
Entry
CpC231_0086       CDS       T01877                                 

Gene name
yusR
Definition
(GenBank) Short-chain dehydrogenase/reductase yusR
Organism
cpq  Corynebacterium pseudotuberculosis C231
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
87404..88105
Genome map
AA seq 233 aa AA seqDB search
MTKTAIVTGGSSGIGEATARALASDGWYVIVAARRMDRLRRIASEIGGEAIQLDVTSDES
VAHFASCIQQCHLLVNNAGGALGLDPIAEASIADWQWMYETNVLGTLRVTRSLLDVLHDG
AQIINISSIAGIAPYAGGAGYNAAKFGVTAINKVMRIEFAQRNLRVTEINPGRVKTDFSL
IRFHGDQAKADAVYADKLNLTAKDIAESIRWVASVPEHMNIDRMVITPRDQIV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaccgcaattgtgacgggaggttcttctggaattggagaagctacagccagg
gcattagcttctgatggctggtatgtcatcgtggcagcacgtcgtatggacagattgcgc
cgcattgcatcagagattggtggtgaagctatacaactagatgtgactagcgatgagtca
gttgctcattttgcttcctgcattcagcagtgtcacctcctggtcaacaacgctggaggt
gcgcttggcctggaccctatagcggaagcatcaattgcagactggcaatggatgtacgaa
actaacgtacttggcacgcttcgggtgacgcgttctcttcttgatgtgcttcacgacggc
gcacagatcataaatattagttccatcgcaggcattgctccttatgcaggtggtgccggt
tataacgcagcaaagtttggggttactgctatcaataaggtgatgcgtatcgagtttgct
cagcgtaatctacgggtaacagaaattaaccctggacgggttaaaacagacttttcgctt
atccgctttcatggtgatcaagctaaagctgatgcagtttatgcagataagctcaacctc
accgcaaaagatattgctgaatccatcaggtgggtagcttcagtgcctgagcatatgaat
attgatcgcatggttattactccgcgcgatcagatcgtctaa

DBGET integrated database retrieval system