KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0091Help
Entry
CpC231_0091       CDS       T01877                                 

Definition
(GenBank) Hypothetical protein
Organism
cpq  Corynebacterium pseudotuberculosis C231
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
90018..90263
Genome map
AA seq 81 aa AA seqDB search
MFAQDISKAIDRIADDIDSLRKLLTSPEEINFSEMADSFVKLEQAFSFKAYSDAFVAYCA
HINNAGTLVGSKNPSIFLLMV
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgcgcaagatatatctaaagctattgatcggatcgcggatgatattgattctttg
cgtaaacttctgacgtcaccggaggaaattaacttctctgaaatggccgattcctttgta
aaactagagcaggctttttcctttaaagcttatagcgatgcctttgtggcctattgtgct
catattaacaatgcgggaacgctcgttgggagcaaaaatccgtcgattttcttgttaatg
gtttag

DBGET integrated database retrieval system