KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0092Help
Entry
CpC231_0092       CDS       T01877                                 

Definition
(GenBank) Hypothetical protein
Organism
cpq  Corynebacterium pseudotuberculosis C231
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
90326..91321
Genome map
AA seq 331 aa AA seqDB search
MGEDIRENAARTKIEKIKIIDRELRSLKKNTELETYQLRAEFIAKAQGMGAEALGQYTRN
RVKELNRKADPDPYAALKRRKITISKPDKDGGVYVSGYLPPATGVLLKSLLSPARRKGVA
SSVAPEEDKRTWAQRRVDVFHQCLAQSSSLIAKQNGGVGTVIVSTTIEELEKADCSTRFY
TNTDIELSPLDLLMLGLREDLFACLMDKQGIPLQLGRSKRTASIYQRLALVAREAVCSHP
NCEQPASNCDVHHLIAWFDGGRTDLENLTLLCRHHHTSNNDRRDFRFGVGHYQRDAGVVK
FYRPGVPPEENQAPARRKSAGYRIRMAEKSA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagatattcgagagaatgcagcaagaacaaaaattgaaaaaataaagatcatt
gaccgagaattgcggagcctaaagaaaaacactgagctagagacttatcagttacgggcg
gaatttatcgcgaaagcacaaggcatgggtgcagaagctcttgggcaatacacgagaaat
cgtgtgaaggagcttaatcgtaaggctgatccagacccctatgctgcgcttaaaaggaga
aaaatcaccataagcaaaccggacaaagatggtggggtatatgtgagtggttatttacca
ccggctacgggtgttcttcttaaatctttgcttagccctgcgaggcgaaaaggggttgca
tcgtcggttgctccggaagaagataagcggacatgggcgcaacgacgggtcgatgtcttc
catcaatgcttggcccagagttcttccttgattgcaaaacaaaatggtggtgtagggact
gttattgtgtctacgaccattgaagaacttgaaaaagctgattgctctacgcgcttctac
acaaatacagatattgagctttctcctctcgaccttctgatgctaggtcttagagaagat
ctctttgcttgccttatggataaacaagggattccactacaactggggcggagtaaacgt
actgccagcatctaccagcgtttagcattggtggcaagagaggcagtgtgttcgcatcct
aattgcgaacaacccgcttccaattgcgatgttcaccacttgatagcttggtttgatggt
ggtcgcaccgatctagaaaatttaactttattgtgtagacaccaccacaccagcaataac
gatagaagagattttcgttttggtgtagggcattatcagagagacgcgggagtcgtaaaa
ttttatagaccgggtgttccacctgaagaaaatcaggctcccgccagacgcaagtcggcg
ggataccggataaggatggcggagaagtctgcctag

DBGET integrated database retrieval system