KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0096Help
Entry
CpC231_0096       CDS       T01877                                 

Gene name
pepO
Definition
(GenBank) Metalloendopeptidase
  KO
K07386  
putative endopeptidase [EC:3.4.24.-]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Brite
Enzymes [BR:cpq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     CpC231_0096 (pepO)
Peptidases [BR:cpq01002]
 Metallo Peptidases
  Family M13: neprilysin family
   CpC231_0096 (pepO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(94512..96383)
Genome map
AA seq 623 aa AA seqDB search
MTSQQPLMKDLYRFVNGEWLDTHVIPEDRGVDGTFHSLRDQAEVDVHELVKSSSSRAGKL
YASFMDVPGIEAAGVAAIDEDLDRLKVETTNELATALGELDRLGVGGPVSFWVAKDSDGS
DSVAYIVQSGLGLPDEAYYREHPDMLESYKAHVTTMLGFLDPQRLGGLPAEEASERIVAL
ETDIARGHWDVVSTRDALKTFNPTEFSELPENVATLLRAARLPESRVIVMMPSYLDHINT
LLSERIDDWKLLTTWHILHARAGVLTPEISRADFAFFGTTLSGATQQRDRWKRAVGLAES
FVGEEIGEVFVKEHFPASSKKDMATLVDYLIAAYRERIEHLQWMTPVTRKRALEKLDKFN
AKIGYPDTWRDYGDLEFSDAGQDLLRNVRTGSAYAHDYELSKLGKPADRSEWVTTPQTVN
AFYNPVVNDITFPAAILRAPFYSPTADAAENFGAIGAVIGHEIGHGFDDQGSQYDGDGNL
HSWWTEEDREAFTQLTSKLVEQFDGLVPSVLKESTGVNGKFTLGENIGDLGGLGIAVVAY
QRYLADHGEDTTGLQRLFLSWARIWRTAIRPELAEQYLAIDPHSPAEFRCNVIAGNIAEF
YQTFNVPEDSPMWIAPEKRVTIW
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgacttctcagcaacctttaatgaaggatctgtaccgttttgttaatggcgagtggtta
gacactcacgttatccccgaagatcgaggcgtggacgggacattccatagcctccgcgat
caggcagaggtcgatgttcatgagctggttaaatcctcgagttcacgggcaggaaaactt
tatgcctccttcatggatgtccccggaatcgaggcagctggagtagctgctatcgatgaa
gatttggatcgtctgaaagtagaaaccacaaacgaactcgccacggctttgggcgagctc
gatcgtttaggtgttggcggccccgttagtttttgggtagccaaagattccgatggtagc
gattcggtagcctacatcgttcagtctgggcttgggcttcccgatgaggcttattatcga
gagcatccggacatgctcgaatcatataaagcgcatgttactacgatgctaggttttctc
gacccacagcggctcggcggactaccggccgaggaagcttcagagcgcatcgtggcgctt
gagacggacatagcacggggtcattgggatgtagtaagcacccgagacgcgctaaaaacc
tttaatccgaccgagttttccgagcttccggagaacgtcgcaacgcttctacgggccgca
cgacttcctgaatcccgcgtaatcgtcatgatgccctcctacttggatcacataaatacg
ctactttctgagcgtatcgacgattggaagctgcttactacctggcacatcctccatgcg
cgcgcaggagtgctcacccctgaaatctcgcgcgcagacttcgcattctttggcaccacc
ctttccggcgctacccagcagcgtgaccgttggaagcgtgctgtcggactcgcagaaagt
tttgttggcgaggaaatcggtgaggtctttgttaaagaacacttcccggcctcctctaaa
aaagatatggcgactttggttgactacctcatcgctgcgtaccgggagcgcattgagcat
ctgcagtggatgacaccagtaacccgcaagcgagcactggaaaaactggataaattcaac
gccaagatcggctacccagacacctggcgcgattatggcgatctagagttctccgacgct
ggccaagatcttctccgcaacgtccgtacaggttccgcttatgcccatgactacgagctc
tccaagttaggcaagcccgcggaccgctctgaatgggtaaccacgccgcaaaccgtcaat
gcgttttataaccctgtggtcaatgacatcactttccccgctgcgatcttacgggcgccg
ttctactcgcccacggcggatgccgccgaaaactttggcgcaatcggtgcagtcatcggg
catgaaattggccatggttttgatgaccaaggcagccaatacgacggcgacggcaacctg
cactcctggtggaccgaggaggaccgcgaggcctttacccaactcacctcaaagctcgtc
gagcaattcgacggcctagtcccttctgtgcttaaggaatccaccggcgttaacggaaaa
ttcacgctcggagaaaatatcggagacctcggcggcctaggcatagcagtagtcgcttat
cagcgctacctagccgaccacggggaggacacgacaggactccaacgcctcttcctgtca
tgggcccgcatctggcgcacagcaatacgccctgaactggcagaacaatacttggccata
gatccgcactcgccagcagagttccgctgcaacgtcattgcaggcaacatcgctgagttc
tatcagacctttaacgttccagaagactccccgatgtggatcgcaccggaaaaacgcgtc
acaatctggtaa

DBGET integrated database retrieval system