KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0102Help
Entry
CpC231_0102       CDS       T01877                                 

Definition
(GenBank) Decaprenylphosphoryl-D-2-keto erythropentose reductase
  KO
K16652  
decaprenylphospho-beta-D-erythro-pentofuranosid-2-ulose 2-reductase [EC:1.1.1.333]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Brite
Enzymes [BR:cpq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.333  decaprenylphospho-beta-D-erythro-pentofuranosid-2-ulose 2-reductase
     CpC231_0102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(104249..105010)
Genome map
AA seq 253 aa AA seqDB search
MLNAVGKAQNILLLGGTSEIGLAIVNEFLTHGPAHVTLAARKDSPRIDAAVKDIESAGAS
AVEVIDFDATAFDTHADVIDQAFLLGDVDVAIVAFGTLGDQEELWQDQSKAVASAETNYT
APVSVGVLLAEKFKAQGHGTIVALSSVAGQRVRRSNFVYGASKAGMDGFYVNLGEALRDY
GVNVLVVRPGQVRTKMSADAGEAPLTVDREDVAKATVQAVLSGKSSIFVHPLFEYVSLVF
KFIPQAIFRKLPF
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacgcagtgggcaaagcccaaaacatcctcctcctcggtggcacatccgagatc
ggcctagctatcgtaaacgagttcctgactcacggtcccgcacacgtcacccttgctgcg
cgcaaggattcgccgcgtatcgacgccgccgtgaaggacatcgaatcagctggcgcatcc
gccgttgaggttatcgacttcgacgcaactgcctttgatacgcacgccgatgtcatcgac
caggctttccttctcggagacgtcgacgtagccatcgtggcctttggcactcttggggac
caagaagaactttggcaggaccagtccaaggctgtggccagtgccgagaccaactacacc
gcaccggtatccgttggtgtactcctcgcggagaagttcaaggcccaaggccacggcact
atcgttgccctgtcctctgttgcaggtcagcgtgttcgccgctccaactttgtttatggt
gcttccaaggctggcatggacggcttctacgtcaacctaggcgaggcccttcgcgattat
ggcgtcaacgtccttgtcgtacgcccaggtcaggtgcgtaccaagatgtccgctgatgcg
ggagaggctccactcacggtggatcgcgaggacgtagctaaggcaactgtccaagcggtt
ttgtccggaaagagctccatcttcgttcatccactgttcgaatatgtctcgcttgttttc
aagtttattcctcaggcgatcttccgaaagctaccgttctag

DBGET integrated database retrieval system