KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0103Help
Entry
CpC231_0103       CDS       T01877                                 

Gene name
dprE1
Definition
(GenBank) Decaprenylphosphoryl-beta-D-ribose oxidase
  KO
K16653  
decaprenylphospho-beta-D-ribofuranose 2-oxidase [EC:1.1.98.3]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Brite
Enzymes [BR:cpq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.98  With other, known, physiological acceptors
    1.1.98.3  decaprenylphospho-beta-D-ribofuranose 2-dehydrogenase
     CpC231_0103 (dprE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(105026..106492)
Genome map
AA seq 488 aa AA seqDB search
MTSAKGTSSTAASSGVSGALHTEAMKLTGWGRTAPTTAEVLATPDLETIVKAVRQVAEQN
DSKPDYLRRGVIPRGMGRSYGDPAQNAGGLVIDMQPLNKIHSIDPETAIVDVDGGVTLDQ
LMKAALPYGLWVPVLPGTRQVTIGGAIGPDIHGKNHHSAGSFGDHVTSMELLVADGRILH
LEPEGSADDPDGSLFWATVGGMGLTGIIVRAKIRMTKTETAYFIADGDLTANLDETVEFH
SDGSESNFTYSSAWFDAISPEPKLGRAAISRGSLATLAQLEELSPKLAKDPLKFNAPQLV
TVPDIFPSFTMNKLSMIAIGELWWLKSGTYRNKVQNLTQFYQPLDLIGEWNRGYGSKGFL
QYQFVVPREAVEPFKDIVRDIQRSGHYSALNVFKLFGEGNRAPLSYPMPGWNVCVDFPIK
PGLGKFLDELDRRVMEFGGRLYLAKESRTSAENFHSMYPEMEGWLKTRNAIDPTGVFASD
MSRRLELH
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcgccaagggcacgtccagcaccgcagcttcgagcggtgtctccggagcctta
cacacagaagccatgaaactcaccggttggggacgcaccgcccccacaaccgcagaggtc
ctcgcaactccagatttggagaccatcgtcaaggcagtacgccaggtcgccgagcaaaat
gactccaagccagactatctccgtcgtggcgtaatccctcgcggtatgggccgctcctac
ggcgatcctgcacaaaatgctggtggccttgtcattgatatgcagcctttgaacaagatc
cactctattgatccagagaccgccattgtggatgttgatggcggtgtgacccttgatcag
ttgatgaaggcggctctcccctacgggctgtgggttcctgttcttccaggtactcgtcag
gtcaccatcggcggcgctatcggcccagatatccacggaaagaaccaccactcagctggt
tctttcggtgatcacgtcacctccatggaactgctagtggccgacggtcgcatcttgcac
cttgagccagaaggctcggcagatgatccagacggttctctcttctgggcaaccgttggc
ggcatgggcctcaccggcatcattgtccgtgcaaagatccgtatgaccaagacggaaacc
gcttacttcatcgcagacggcgacctcaccgctaacctcgatgaaaccgtggaattccac
tccgacggttccgagtccaacttcacctattcctccgcttggttcgacgccatcagcccg
gagcccaagctaggtcgcgccgccatttcacggggttccctagccacactcgcgcagctg
gaagagctctcccccaagctggccaaagatcccctgaagttcaatgccccacagcttgtg
acggttccggatattttcccttccttcaccatgaacaagctttctatgatcgcaatcggt
gaactttggtggctcaagtcaggcacgtacaggaacaaggtgcaaaacctcacccagttc
tatcaaccgctcgacctcatcggagagtggaaccgcggttatggttctaagggcttcctg
cagtatcagttcgtggttccacgtgaggctgtcgaaccattcaaagatatcgtccgcgat
atccagcgttccggacattactccgcactcaacgtgtttaagctcttcggagaaggaaac
cgtgcgccgttgagttatccgatgccgggttggaacgtctgcgtagacttcccgattaag
ccaggactaggcaagttcctcgatgagcttgaccgccgtgtcatggagttcggtggacgc
ctctacttggccaaagaatctcgtacgagcgctgaaaacttccactcgatgtatccagaa
atggaaggctggctcaagacacgtaatgcgatcgaccccactggcgtcttcgcttctgac
atgtcccgccgcctcgagctacactaa

DBGET integrated database retrieval system