KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0104Help
Entry
CpC231_0104       CDS       T01877                                 

Definition
(GenBank) Hypothetical protein
Organism
cpq  Corynebacterium pseudotuberculosis C231
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(106576..106800)
Genome map
AA seq 74 aa AA seqDB search
MFGFLKKKTVETHIAAERTNTPMDSRMTLLMAEEIPMLDSASRVRIYQILEEYDGPQITS
QEELPQEIRDMMDL
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgtttggattcctcaaaaagaagaccgtggaaacgcatatcgcggcagaacgcacaaat
actcccatggattcccgcatgaccctcctcatggctgaggaaatccccatgctagatagc
gcttctcgagtgcgtatctatcaaatcctcgaggaatatgacggtccgcaaattacgtcg
caggaggaacttccccaggaaattcgcgacatgatggacctgtaa

DBGET integrated database retrieval system