KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0109Help
Entry
CpC231_0109       CDS       T01877                                 

Gene name
glfT1
Definition
(GenBank) UDP-galactofuranosyl transferase GlfT1
  KO
K16649  
rhamnopyranosyl-N-acetylglucosaminyl-diphospho-decaprenol beta-1,3/1,4-galactofuranosyltransferase [EC:2.4.1.287]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Brite
Enzymes [BR:cpq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.287  rhamnopyranosyl-N-acetylglucosaminyl-diphospho-decaprenol beta-1,4/1,5-galactofuranosyltransferase
     CpC231_0109 (glfT1)
Glycosyltransferases [BR:cpq01003]
 Polysaccharide
  Bacterial polysaccharide
   CpC231_0109 (glfT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(109215..110117)
Genome map
AA seq 300 aa AA seqDB search
MPIASTGRIAAVIVTHNRVELLQNSLKIVAQQTHPVDHIIVVDNGDDPAVESLVTAIAGE
RAVYLGSKHNLGGAGGFALGFLTALRLGADAVWCADDDGRPEDENVLATLLHVAKKHHLD
EVSPVVCNAEEPDQLAFPLRRGTTWRRFRSELGNEDFLAGIASLFNGALISADAMQRIGV
PDLRLFIRGDEVEYHRRLVRSGLKFGTCLTAAYLHPDGSDEFKPILGGRMHTQYPDNEGK
RFFTYRNRGYLMNQPGMRRLLPQEYARFGWFFLIQRKDPKGFLQWLKLHHMGRSERFERP
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcctatagcttctactggtcgcatcgcggctgtcattgtcactcacaaccgcgtcgag
ctgttgcagaattctttgaagatcgttgcgcaacagacgcatcccgtagatcacatcatc
gttgtagataacggtgatgatcccgccgtcgagagcctagttaccgctatcgccggcgag
cgcgccgtctacctcggaagcaaacataatttgggaggagccggcgggtttgcgcttggt
tttctcaccgcgctgaggctgggagccgacgctgtctggtgcgccgatgatgacggccgc
ccggaagacgagaatgtcctggcaaccctcttgcacgtagcaaaaaagcaccacctcgat
gaggtctccccggttgtttgtaatgcagaagaacctgaccagctggcattcccgcttcgc
cgtggcaccacgtggcgtaggttccgcagtgaactcggcaatgaggatttcctagcaggt
attgcttcgctatttaacggcgctcttatctccgctgatgctatgcaacgcatcggcgtc
cccgacttgcgtctgtttatccgaggcgatgaagttgagtatcatcgccgactagtgcgt
tccggcctcaaatttggcacctgtctcaccgctgcttatctgcacccggatggctcggat
gagtttaagccaatccttgggggacgcatgcatacgcaatacccagataacgagggcaag
cggttcttcacttatcgcaaccgcggataccttatgaatcaacccggtatgcgtcggctt
cttccccaggagtatgcgcgatttggctggttcttcctcattcagcgcaaagaccctaag
ggatttttacagtggctcaagctccaccacatgggccgctcggagcgctttgaacggccg
taa

DBGET integrated database retrieval system