KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0112Help
Entry
CpC231_0112       CDS       T01877                                 

Gene name
mntB
Definition
(GenBank) Manganese/zinc/iron transport system ATP-binding protein
  KO
K11710  
manganese/zinc/iron transport system ATP- binding protein
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
ABC transporters
Module
Manganese/zinc/iron transport system
Brite
KEGG Orthology (KO) [BR:cpq00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CpC231_0112 (mntB)
Transporters [BR:cpq02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/zinc/iron transporter [MD:M00319] [OT]
    CpC231_0112 (mntB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
111420..112145
Genome map
AA seq 241 aa AA seqDB search
MANLVGSALTMTGISVSYGPTVALENASIEVPVGSVMGFIGPNGAGKSTLIKSAIDLVDH
DGEVAFFGKPLAQVRDRVAYMPQSAAVDWDYPITVEQVVGMGLYPRLGWFKRFTGKHREE
VRHALERVGIADLAKRHISELSGGQRRRVFVARILVQNPDIFLLDEPFAGVDAASERVIR
DVLHGLCEDGKSVVIVHHDLSTVTELCDHVTVINRQIVATGTVEEAFTRETVNAAFGLGL
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtggccaatctagtgggctcggcattgacaatgacgggcatcagcgtgagctatgggcca
acggtggccctggaaaatgcaagtattgaggttcctgttggatctgtgatgggttttatc
gggcctaatggggcaggaaaatctactcttattaagtctgcgatcgatcttgtagaccac
gacggtgaggtcgctttctttggcaaaccgctcgctcaagtacgtgatcgtgttgcttac
atgccgcaatccgccgctgtggactgggattaccccatcaccgtggaacaagtggtgggc
atgggactatatccgcgtttaggttggttcaaacgtttcaccgggaagcaccgggaagag
gtgcggcacgctcttgagcgggtaggcatcgctgatttggctaagcgccatatttccgag
ctctccggtgggcaacggcgccgtgtctttgttgcaagaattctggtgcaaaatcccgat
atctttctgttggacgagccttttgcgggtgtcgacgcagccagcgagcgtgttatccgt
gatgttttgcatggtttgtgtgaagacggaaaatcggtggttattgttcatcacgacttg
tctacagtgacagaactttgcgatcacgtcaccgtaatcaatcggcagatcgtagcaacc
ggaactgtagaagaagcgtttacccgggagaccgtgaatgctgcttttggcctggggttg
ttatga

DBGET integrated database retrieval system