KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0117Help
Entry
CpC231_0117       CDS       T01877                                 

Gene name
pgpB
Definition
(GenBank) Phosphatidylglycerophosphatase B
  KO
K19302  
undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cpq00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CpC231_0117 (pgpB)
Enzymes [BR:cpq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     CpC231_0117 (pgpB)
Peptidoglycan biosynthesis and degradation proteins [BR:cpq01011]
 Precursor biosynthesis
  Diphosphatase
   CpC231_0117 (pgpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
114817..115551
Genome map
AA seq 244 aa AA seqDB search
MYPPFSQAGSTSLEVEKTMEVPSSHAKVSAQRWWTAIIGVLAVAIIGLGVRSLTSDLFIT
QAMNNQRKGAIESLVDAVYYGLEPAYSLVLTLVISALVGIACKQVRIGLQCAVAIAITWV
PVVFVKMLIERPRPSSDLLAHPIPVTPGDWSFPSGHTTYVTALAMMLMLTVGARLPLILR
ALLVLCAVLVIAGVVLTMGVHYLTDVVAAVIWSTTMAPLVWNLVDNAGRRLWFSRFENAG
RPSV
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtatccaccgttttctcaagcggggagtacatctcttgaagtggagaaaacaatggaa
gtaccatcctctcacgcaaaggtgagtgctcagcggtggtggactgcgattatcggagtt
ctagcggtagcgattatcgggctaggggttagatcactaaccagcgatctttttatcacc
caagccatgaataatcagagaaaaggggcaattgagagccttgtagatgctgtttactat
ggtttggaacccgcttattcgctggtactcacgctggtaatttctgcgctggtgggcatt
gcgtgcaaacaagtccgaatagggctgcaatgcgcagtggccattgcgatcacctgggtg
ccagtagtttttgtaaagatgcttattgagcgtcctcgccctagctcagacttgcttgct
caccccataccggtaacgccaggggattggtcgtttcctagcgggcacacgacgtatgtg
acggctttagccatgatgctgatgcttacggtgggtgctcggctgcctttgatcctacgg
gcccttctggtgctctgcgctgttctagttatcgcaggcgtggtgcttaccatgggcgtg
cactacctcacggatgtagttgctgctgttatctggagcaccacgatggccccgctcgtg
tggaaccttgtagataacgcggggcgacgtctgtggtttagtcgttttgagaacgctggc
cgccccagcgtttag

DBGET integrated database retrieval system