KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0118Help
Entry
CpC231_0118       CDS       T01877                                 

Gene name
rfbE
Definition
(GenBank) O-antigen export system, ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
cpq  Corynebacterium pseudotuberculosis C231
Module
cpq_M00254  ABC-2 type transport system
Brite
Transporters [BR:cpq02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    CpC231_0118 (rfbE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_16 MMR_HSR1 AAA_23 RsgA_GTPase AAA_15 AAA_18
Motif
Other DBs
NCBI-ProteinID: ADL09616
UniProt: D9QDP3
Position
complement(115598..116392)
Genome map
AA seq 264 aa AA seqDB search
MVSIDTYNACVDFPIFDAKSRSMKKAFLGAAGGAIGRNKDNTVVVEALRDVNLHLKEGDR
IGLVGHNGAGKSTLLRLLSGIYEPTRGSAHVRGRVAPVFDLGVGMDPEISGFENIVIRGL
FLGQTRKQMKQKMDEIAEFTELGDYLAMPLRTYSTGMRIRLALGVVTSIEPEILLLDEGI
GAVDAAFMAKARERLSDLVQRSGILVFASHSNDFLVQLCDSALWIDHGTVRQAGAVDDIV
EAYEGKGAADHVRRLQKRIREESK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggtttccattgatacctataacgcctgcgttgatttccccatattcgacgcaaaatcg
cgttctatgaagaaggcattcctaggcgccgcaggtggcgccattgggcgaaacaaagac
aataccgtggtcgtggaggcgcttcgagacgtaaacctgcacctcaaagagggtgaccgc
atcggcctcgtaggccataacggtgccggaaaatccacactcttacgtctactctccgga
atttatgagcccacccgtggctccgctcatgtccgcggacgcgtcgcccctgtttttgac
ctcggcgtaggcatggacccggagatctcggggtttgaaaacatcgtgatccgcggcctg
ttcctggggcagacacgcaagcagatgaagcaaaaaatggatgagatcgccgagttcacc
gaactaggcgactacctagccatgcccctgcgtacatactccactggcatgcgtattcgt
cttgctctcggggtagtcacctcgattgagcccgaaattttgcttctcgacgaaggcatc
ggcgccgtcgacgccgcctttatggctaaggcccgcgaacgcctctccgacctagtgcag
cggtctggcatcctcgtttttgcctctcactccaacgatttccttgtccagctctgtgac
tcagctctttggattgaccacggaacggtgaggcaggcaggggccgttgatgacatcgta
gaagcctacgaaggcaaaggcgccgcagaccacgtacgacgcctgcaaaagcgcatccgc
gaagagtctaaatag

DBGET integrated database retrieval system