KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0120Help
Entry
CpC231_0120       CDS       T01877                                 

Gene name
csd
Definition
(GenBank) Cysteine desulfurase
Organism
cpq  Corynebacterium pseudotuberculosis C231
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
117455..118648
Genome map
AA seq 397 aa AA seqDB search
MVFDVARVRGAYTSVSGTWTYLNAQEQPQIPERVSSAVSRGFRSAPLAAEIERGAGSHAL
LQRAGRFIADDHFYSARMAIADMTGTSADAVLLGPSRDVLFARLSRALRPLLRRGSSAVF
SRTDSCGLDLDAEIRWAEPDLGTGEVPAWQFSKLVDGSTRVVALSAASRQVGTINPILEI
AEYVHDSSRAWVLVDATPLAGHRPITREALGADIISVDCEAFGGPQVAALAFRDTTMFPR
IDMEVFDTPVAAGLAAGVSAAVDHLADLDEDARGTRRYRLAQGVESAANYLGWLGTYLVD
SIESLPNTHVFGVTGEAAAGSDVDRIPHATFCINGVPADMIQQRLINNGLVATVAEADPL
LTAMGVGDTKGAISVGLGPYNTVADVDQLIRVVASLA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttgacgtagctcgtgttcgaggtgcttatacctccgtgagcggtacttggact
tatctcaatgcgcaggagcaaccacaaattccggaacgggtgtcatctgctgtttcgcga
ggttttcgcagtgcgccgttggcagcagaaattgagagaggcgccggttctcatgcgttg
ttgcaacgcgcggggcgctttattgcagacgatcacttttattctgcacgaatggcgatt
gcggatatgacaggaacctcagcagacgcggtgctcctggggccgagccgtgacgtgctt
tttgcacggttatcccgcgcgttgcggccactgttgcgccggggatcttccgctgtgttt
tcgcgcacagattcctgtggtcttgatctggacgcagaaatacgttgggcggaacctgac
ttaggtactggtgaggtgcctgcgtggcagttttccaagcttgtcgacggcagcacccgc
gttgttgcgctctccgccgctagccggcaggtaggaacaatcaatccgatcctggaaatc
gcggaatacgtgcatgattcctcccgtgcgtgggtgcttgtcgacgccaccccacttgct
gggcatcgcccgatcacgagggaagcattaggcgcggacatcataagcgtggactgtgag
gccttcggtgggccacaggttgccgccctggcgttccgtgacaccacgatgtttcctcgc
atagatatggaagtgtttgatacgcctgttgccgctggccttgccgcgggagtatccgca
gccgtagatcaccttgctgatctcgacgaggacgcccggggaactcgtcgttaccgcttg
gcgcagggtgtggagtccgcggcaaattatctggggtggttggggacctatcttgtggat
tccatcgaatcgcttcccaacacccacgtctttggcgtgaccggtgaagccgccgcaggt
tcggacgtggatcggatcccacacgccacattctgtatcaacggcgttccggccgacatg
atccagcagcggctgataaacaatggattggtggccacggtggctgaggccgaccccctt
ctcaccgcgatgggggtcggcgatactaagggggccatctccgttggattggggccttat
aacacggtcgcggatgttgatcagctcatccgcgttgtggcgagcttggcctag

DBGET integrated database retrieval system