KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0149Help
Entry
CpC231_0149       CDS       T01877                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpq03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
150536..151192
Genome map
AA seq 218 aa AA seqDB search
MFEGPLQDLIDELSRLPGVGPKSAQRIAFHLLHVEPADIARLQDALGAVRDGVTFCRICC
NISRESVCRICADSGRDRGTICVVEEPKDIQVIERTGEYNGRYHVLGGALDPLANIGPRE
LNISTLLQRIGGVLPDRELADSTPDAPLYDSSPTVTEVILATDPNTEGEATASYLARLLR
DFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLTI
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaaggaccgcttcaggaccttattgatgagctttcacggctccccggcgtgggc
cctaaatctgctcaacgcatcgcttttcacttgcttcatgtggagcctgcggacatcgca
agacttcaggatgccctcggtgctgtccgagatggcgtgaccttttgtcgtatttgctgc
aatatctcccgcgaatcggtatgccgtatttgtgcggattctggccgggatcggggaacg
atctgcgtggtggaggaacccaaagatattcaggttattgagcggacgggcgaatataat
ggccgctaccatgtgctgggtggggcgttggatccgctagctaatattggtccccgtgaa
ctgaatatttctacgttgctgcagcgcattggaggggtgcttcctgatcgagagctagcg
gattctacgcctgatgcgccgctgtatgattcctctccgacggtgacagaggttattctt
gccaccgaccccaataccgagggtgaggcgacggcttcttatcttgcacgtctgctccga
gattttcctgatttggtggtttctcgtctggcttccggtatgcctttgggcggggaccta
gaatttgtggatgaactgacattgtcccgcgccctgagcggtcgattgacaatttaa

DBGET integrated database retrieval system