KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0158Help
Entry
CpC231_0158       CDS       T01877                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
Organism
cpq  Corynebacterium pseudotuberculosis C231
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(158049..159344)
Genome map
AA seq 431 aa AA seqDB search
MSLNLRTRLAIGTAHLATTASRVTGRGSGGMIGGLIAEKIDPNIMASLGDDRPVALVTGT
NGKSTTTRMLASAIRAQHTVATNEGGDNMDAGIISALMAGQKASHVILEVDELHVPAVAD
RLKPSCLILLNLTRDQLDRVGEINKIERALRDCVTKHPEMTVIANCDDVLVTSIAYDAKN
VVWVSAGAGWQGDSVSCPRTGGHVVHDGADWYAVKPLPNGEQFRRPTPHWSITAEGIVSP
ADIGSSTGSDAPMTQEVSPLNLALPGNANRGNATQAVAAAVECFQVPLNQAVRSVESVDD
VAGRYSTITLGQHQIHLLLAKNPAGWQEALSMVDRTAEGLVIAVNGQVADGEDLSWLWDV
KFEELDKLSVKASGERGTDLSVRLTYASVEHELIKNPLQAIKACPAGRVEVLANYTAFRD
LKKAIAAVKES
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaatctgcgtactcgtcttgccatcggcaccgcacacttagccacaacggcg
tcgcgtgtcaccggtcgtgggtcgggcggaatgattggcggccttatagccgagaaaatc
gacccgaacattatggcctctctaggcgatgaccgtcccgtagcccttgtcaccggtacc
aacggtaaatccactaccacccgcatgctcgcatccgcgatacgtgcacagcacactgtg
gcaaccaacgagggcggcgacaatatggacgccggcatcatctctgcgctcatggcaggc
caaaaagctagccatgtgatccttgaagtagacgagctccatgttcccgccgtagcagat
cgtctcaagccatcatgcttgatcctcctcaacctcacccgcgatcagctggacagagta
ggggaaatcaacaagattgagcgcgcactacgcgattgtgtgaccaagcatcctgagatg
actgtgatcgccaactgcgacgacgtccttgtcacttccattgcttacgacgctaaaaac
gttgtatgggtatccgcgggggcaggatggcaaggcgattccgtctcctgcccgcgcact
ggcgggcacgtggtccacgacggcgccgactggtacgcagtcaagccccttcccaacggc
gaacaattccgtcgcccaaccccgcattggagtatcaccgctgagggcatagtctctccg
gccgacatcggctcgtcgacaggctcagacgctcccatgacgcaggaggtatcgccgctg
aatctggctcttcctggcaacgccaatcgcggcaatgccacccaagcggtagctgccgca
gtggaatgcttccaggtccctcttaaccaggcggttcgctcggtagaatctgtcgacgat
gtggctggacgctactccacaatcactcttgggcagcatcagattcatctgcttttggct
aaaaacccagcgggatggcaggaagccctctcaatggtcgatcgcaccgcagaaggccta
gtgattgcggttaacggccaggtcgccgatggtgaagacctctcttggctctgggacgtt
aagtttgaggagctagataagctctctgtaaaagcctccggcgaacgcggcactgacctt
tcagtgcggctgacatatgcctctgtagagcacgaactgatcaagaatcctttgcaggct
atcaaggcttgtcccgctggtcgtgtcgaggtccttgccaattacactgcattccgcgat
ttgaaaaaggccattgcggccgtaaaggagtcctaa

DBGET integrated database retrieval system