KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0163Help
Entry
CpC231_0163       CDS       T01877                                 

Gene name
deoD
Definition
(GenBank) Purine nucleoside phosphorylase
  KO
K03784  
purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CpC231_0163 (deoD)
   00240 Pyrimidine metabolism
    CpC231_0163 (deoD)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CpC231_0163 (deoD)
Enzymes [BR:cpq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     CpC231_0163 (deoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
164515..165231
Genome map
AA seq 238 aa AA seqDB search
MAEKSTPHINPRGVDIADTVLLPGDPRRAKFIAETYLDDVVQFNEVRNMLGYTGTYKGTP
VSVMGSGMGMPSIGIYSWELINIFGARNVIRVGSIGSLQEDINLYDIIVASSASTDSNFL
EQYNLPGTYAPTASWKLLKAIVDEADKAGQKVHVGNILSSDIFYNADETASARWARMGVM
GVEMESAALYSIAAYAGAHALGLFTVSDNIPKGESTTSEEREKAFTSMMEIALPLAGI
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaagtccacgccccatatcaacccacgcggtgttgacatcgcagatactgtt
ctgcttcccggcgacccacgccgcgctaaatttattgcagagacgtacctcgatgatgtt
gttcaattcaatgaggtgcgcaacatgcttgggtataccggaacttataaaggcactccg
gtttctgtgatgggatcgggaatggggatgccatccattggcatctactcgtgggaactc
atcaatatctttggcgcgcgcaacgttattcgggtgggctcgatcggttctttgcaggaa
gacattaatctttatgacatcatcgtggcgtcgtctgcctccacggactctaacttccta
gagcagtacaacttgccgggcacatatgcgcctaccgcgtcctggaaactgcttaaagcc
atagtcgatgaggcggataaggctggtcagaaagttcacgtgggcaatattttgtcctca
gacatcttctataacgccgatgagacggcaagtgctcgttgggctcgcatgggggtcatg
ggcgtggagatggaatcggcagcactgtactccattgccgcatacgccggagcgcatgcg
ctgggtctctttacagtctcagacaatattcctaagggggaaagcaccacatctgaggaa
cgtgaaaaggcattcacctcgatgatggaaatcgctcttcccctcgcaggaatctag

DBGET integrated database retrieval system