KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0170Help
Entry
CpC231_0170       CDS       T01877                                 

Definition
(GenBank) Hypothetical protein
Organism
cpq  Corynebacterium pseudotuberculosis C231
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
175359..176465
Genome map
AA seq 368 aa AA seqDB search
MRPRRMVIWQDWVAAAVLFIVSALVRLTFLLWMRGDASLESLISKWDGRIYLAIAKYGYF
SDVGGAPDPEVYQTRLAFFPGYPGLIAAVHSVTRLNYVTSALVISYAAGIVMTAGVMAMA
ARMGANRRLRLCAAMLVLGAPMSTTFTMVYTESVFLACAVWALVAMTDKRWLLAGAFTFC
AGFFRLTAVDLVAAFAVVVAVYAARNWRAWAAVAVSMLPLVSYLFYASSYTRDIGGYFGL
QTKGWHSTFDFGRATVIWVSTQLREGNNVGYLLSIASIVGAMGAVIVSFRRLPLSYWLFG
AAVTANVVLSDGIMHSRPRLLLPAVVLLIPVIFQFSQRRYALPAVATCWLLFGAWFSAYM
IAVFEWAI
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgaggccacggcgcatggtgatctggcaggattgggtggctgctgccgtcctttttata
gtgtctgccctggttcgactcacttttttgttgtggatgcgcggcgacgccagccttgag
tctttgatctctaagtgggatgggcggatctatttggctattgccaagtatggctatttt
agtgatgtagggggcgcgccagatcctgaggtctatcagacaaggctcgcatttttccca
ggttatccgggactgatagcagctgtgcactcagtaacgcgattaaattatgtgaccagt
gccctcgtgatttcctacgcggcagggatcgtaatgaccgccggggtgatggcgatggct
gctcgcatgggggcgaacaggcggctgcgcttgtgtgctgcgatgctggtattgggtgcg
cccatgagcactacgttcaccatggtctataccgaatcagtttttctggcttgcgctgtc
tgggccttggttgcgatgacagataaacgctggttactggctggagcatttactttttgt
gctggattcttccggctgaccgcagttgatctggtagcggctttcgccgtggtagttgct
gtctatgcggctcgtaactggcgcgcgtgggccgccgttgctgtgtctatgctcccgttg
gtgagctatctgttttatgcgtcgtcttatactcgtgatatcggcggctactttgggctt
cagaccaaaggatggcactctacctttgattttggtcgcgctactgtgatctgggtgagt
acacagctgcgtgaaggcaacaacgtgggttatttgttgtcgatcgcgtctattgtgggc
gcaatgggcgcagttattgtgtcttttaggcgtctccctctgtcgtattggctgtttggc
gccgctgttacagctaacgttgtgctttccgacggcatcatgcattcacgtccccggctt
ttacttccggctgtggtgcttttaattcccgttattttccaattttcacagaggcgttat
gcgctacccgcagtggcaacatgctggttgctgttcggtgcatggttttctgcatatatg
attgcggtgttcgaatgggcgatttaa

DBGET integrated database retrieval system