KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0172Help
Entry
CpC231_0172       CDS       T01877                                 

Gene name
lysC
Definition
(GenBank) Aspartate kinase
  KO
K00928  
aspartate kinase [EC:2.7.2.4]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
Glycine, serine and threonine metabolism
Monobactam biosynthesis
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cpq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CpC231_0172 (lysC)
   00270 Cysteine and methionine metabolism
    CpC231_0172 (lysC)
   00300 Lysine biosynthesis
    CpC231_0172 (lysC)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    CpC231_0172 (lysC)
Enzymes [BR:cpq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     CpC231_0172 (lysC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
177592..178881
Genome map
AA seq 429 aa AA seqDB search
MSPGRALPVALVVQKYGGSSLESAERIRRVAERIVATKKQGNDVVVVCSAMGDTTDELLD
LAAQVNPVPPAREMDMLLTAGERISNALVAMAIESFGAKAQSFTGSQAGVITTERHGNAR
IVDVTPGRVREALNEGKICLVAGFQGVNRESKDVTTLGRGGSDTTAVALAAALNADVCEI
YSDVDGVYTADPRIVSNACKLDQLCFEEMLELAANGSKILVLRSVEYARAFGVPLRVRSS
YSNDPGTLVAGSMEDIPVEEAVLSGVATDNSEAKITVLGIPDSPGAASVVFRALADAEIN
IDTVLQNISSLEDNRTDITFTCPRADGPHAMELLHNLQSKNDWQNVLYDDQIGKVSLVGA
GMKSHPGVTAEFCEALRDQGINIELITTSEIRISVLIRETDLPAAARALHEKFELGGDEE
ARVYAGTGR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtctccgggaagggcgttgcccgtggcacttgtcgtccaaaaatatggcggttcttcg
ctggaaagcgcggaaagaattcgtcgcgtcgccgagcggattgtggccactaaaaagcaa
ggcaacgacgttgtagtggtgtgctccgcgatgggggatactaccgacgagctgcttgac
cttgcggctcaggtaaacccggtgccgcccgcgcgtgagatggatatgttgcttaccgca
ggggagcgcatctctaacgcacttgtggccatggctatcgagtcatttggcgcaaaagct
cagtcattcacaggctcgcaagcgggtgtaatcaccacagaacgccacggtaatgcccgt
atcgtggacgttactccggggcgagtacgtgaagctctgaatgaaggcaaaatttgtctt
gttgcgggcttccagggcgtaaaccgcgagtctaaggacgtgaccactttgggccgtggt
ggttcggacaccacggcggttgccctggctgcagcgcttaatgctgacgtatgtgagatc
tattcagacgtggacggcgtttatactgctgacccccgtattgttagcaatgcatgcaag
ttggatcagctctgctttgaggagatgctggagcttgcagctaatggctcaaaaattctt
gttctgcgcagcgtagagtatgcccgtgcgtttggtgtacctttgcgcgttcgttcgtcg
tatagcaatgaccccggaactctcgttgccggatcaatggaggatatccctgtggaagaa
gcagtactttctggcgtagcaactgacaactccgaggctaagatcacggtcctgggcatc
cccgattctccaggggctgcctctgtggtattccgtgcccttgcagacgccgagatcaac
attgatacagtcctgcaaaacatctcttccctggaagataaccgcacggatattactttc
acctgcccgcgtgccgacggcccccacgccatggaattgctgcacaatttgcagtcgaag
aacgactggcagaacgtgctttacgacgatcaaataggcaaagtttcactcgtcggcgcc
ggtatgaaatcgcacccaggcgttactgcagaattctgcgaggctctccgcgaccagggg
atcaatattgaattgattactacctctgagatccgtatctctgtgctgatccgtgaaact
gatttgcccgctgctgcacgagcgctccatgaaaagtttgaacttggtggagatgaagag
gctcgggtgtacgcggggacggggcgttaa

DBGET integrated database retrieval system