KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0279Help
Entry
CpC231_0279       CDS       T01877                                 

Gene name
hemB
Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cpq00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
288915..289922
Genome map
AA seq 335 aa AA seqDB search
MSNADLHLIRRPRRLRSTPVMRELVAETTLRPADLILPMFVADGIAEPREISSMPGVYQH
TIPSLIEAVREAISVGIKCIDLFGVPLDADKDAQGSQSWAPDGILNRGIRALRQEFGNDV
IIMADTCLDEFTDHGHCGVLDTDRFGEAVVDNDATIPLYQKMAVAQAEAGAHMVSPSGMM
DGQILAIRDALDAHGFQDVAIMAYSAKYASAFYGPFRDAVGSSLDGDRRTYQQDPANCRE
SLMEVDLDIEEGADFVMVKPAMPYLDVLAEVASTSSVPVAAYQVSGEYAMLHAAARNNWL
DLERVMMESLISIKRAGADQILTYFAVDAAKKLQH
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgcagatctccaccttattcgtcgcccacgcaggctccgaagtacgccagtt
atgcgcgaattagtggcagagacgacgcttcgtcccgccgacctgattcttcctatgttt
gtcgcagacgggatagctgagccacgcgaaatttcttctatgcccggcgtataccagcac
actattccctccttaatcgaggccgttagagaagctatttccgtagggattaagtgcatt
gacctcttcggagtgcctctcgacgccgacaaggacgcacagggttctcaatcttgggca
ccagacggaatcctcaaccgtggcattagagcgttacgccaagagtttggcaatgatgtg
atcatcatggcagacacgtgtcttgatgagttcacagatcatgggcactgcggcgtactc
gacactgatcgcttcggcgaggcagttgtggataacgatgccactatcccgttgtatcaa
aagatggcggtggcgcaagcggaggcaggcgcgcacatggtaagcccctccggcatgatg
gatgggcagattttggcaatccgcgacgccctcgatgctcatggcttccaagacgtagcc
attatggcgtattccgctaagtatgcttcggccttctacggcccattccgtgacgcagtg
ggttcttctttggacggcgaccgtagaacataccagcaggatccggctaattgtagggaa
tcactgatggaagtcgacctagatattgaggagggcgcggactttgttatggtcaaacca
gccatgccttacctcgatgtcctagcagaggtagcctcaacatcgtccgtgcctgtcgcc
gcgtatcaggtatcaggcgaatatgccatgttgcatgcggctgcccgtaataactggctc
gatctggaacgtgtgatgatggaatcgttgatttctatcaaacgcgctggggcagaccag
attcttacttactttgccgtcgacgcggcgaaaaaactacagcactag

DBGET integrated database retrieval system