KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0511Help
Entry
CpC231_0511       CDS       T01877                                 

Gene name
manB
Definition
Phosphomannomutase ManB
Orthology
K01840  
phosphomannomutase [EC:5.4.2.8]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpq00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CpC231_0511 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    CpC231_0511 (manB)
Enzymes [BR:cpq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     CpC231_0511 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
524515..525894
Genome map
AA seq 459 aa AA seqDB search
MRTRESVTKVIKAYDVRGVVGVDIDADFIREVGSAFGHLMRNEGATKVAVGHDMRPSSPE
LTQAFADGLTAQGVDVVALGLTSTDQLYYASGVMDCPGAMFTASHNPAEYNGIKMCRSGA
RPVGQETGLGAIIDMLVEGVPAYDGKPGAITQKDTLADYGSFLRELVDLSGIRPLVVAVD
AANGMGGHTVPEVFAGLPLDVKPLYFELDGTFPNHEANPLDPKNLVDLQKFTPEVKADIG
LAFDGDADRCFVVDENGDPVSPSAICAIVAERYLAQHPGSTIIHNLITSKTVPEVIAENG
GVAVRTRVGHSFIKAQMAEHGAAFGGEHSAHYYFSEFFNADSGILAAMHVLAALGGQDKP
LSELMKEYSRYAASGEINSRLASAEEQAERTQAVLDAFADRTESVDRLDGVTVELQGTKA
WFNVRASNTEPLLRLNVEAPTAEEVDALVTEILGVIRQQ
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacccgtgaatcggtgaccaaggtcatcaaggcttatgacgtgcgaggggtcgtc
ggtgttgatattgatgctgacttcatccgcgaggtaggctcggcttttggccatctgatg
cgcaacgagggcgctactaaggtcgccgtaggtcatgacatgaggccgtcatcacctgag
ctaactcaggcttttgcagacgggctcaccgctcaaggcgttgatgtggttgcgctaggg
ctcacctccactgatcagctgtattacgcttctggcgttatggattgccccggcgcaatg
ttcaccgcatcccacaaccctgccgaatataacggcatcaagatgtgccgctctggcgca
cgacccgtggggcaggaaactggtttgggcgcgattatcgacatgctggtggagggcgtc
ccggcttacgacggcaaaccaggcgctattacgcagaaagataccctcgcggattacggt
tccttccttcgtgaacttgtggatctgtctggcatccggcctcttgttgttgctgtggac
gcagcgaacggcatgggtgggcatactgtccctgaggtttttgcaggacttccactcgat
gtcaagcccctctactttgagctagacggaaccttccctaaccatgaggcaaacccgctc
gaccccaagaaccttgtggacctgcaaaaattcactccagaggtaaaagccgacatcggc
ctagcttttgacggcgacgcagatcgctgctttgtggttgatgagaatggcgacccggtg
agcccctctgctatttgcgccatcgtcgcagagcgataccttgcgcagcatccaggcagc
acgattatccataacctgattacctccaagacggttccggaggtaatcgcggaaaatggc
ggtgttgccgtgcgtacgcgtgtgggacattcctttattaaggcacaaatggcggagcac
ggcgcggcattcggcggcgagcactctgctcattactacttctctgagtttttcaatgcc
gattctggaatccttgcagcaatgcacgtgctagcggctctaggcggacaagacaagcct
ttgtcagagctgatgaaagaatattcgcgttacgcggcatcgggagaaatcaactcacgt
ttggctagcgctgaagaacaggctgagcgcacccaggctgttctggatgctttcgcggat
cgtacggaaagcgttgatcgtctcgacggcgttaccgttgagcttcaaggcactaaggcg
tggttcaatgttcgcgcttccaacacagaaccacttttgcgtcttaacgtcgaggctcct
acggcagaagaagtggacgccctagtcactgaaattcttggggttattcgtcaacagtag

DBGET integrated database retrieval system