KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0511Help
Entry
CpC231_0511       CDS       T01877                                 

Gene name
manB
Definition
Phosphomannomutase ManB
Orthology
K01840  
phosphomannomutase [EC:5.4.2.8]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cpq00051]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cpq00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
524515..525894
Genome map
AA seq 459 aa AA seqDB search
MRTRESVTKVIKAYDVRGVVGVDIDADFIREVGSAFGHLMRNEGATKVAVGHDMRPSSPE
LTQAFADGLTAQGVDVVALGLTSTDQLYYASGVMDCPGAMFTASHNPAEYNGIKMCRSGA
RPVGQETGLGAIIDMLVEGVPAYDGKPGAITQKDTLADYGSFLRELVDLSGIRPLVVAVD
AANGMGGHTVPEVFAGLPLDVKPLYFELDGTFPNHEANPLDPKNLVDLQKFTPEVKADIG
LAFDGDADRCFVVDENGDPVSPSAICAIVAERYLAQHPGSTIIHNLITSKTVPEVIAENG
GVAVRTRVGHSFIKAQMAEHGAAFGGEHSAHYYFSEFFNADSGILAAMHVLAALGGQDKP
LSELMKEYSRYAASGEINSRLASAEEQAERTQAVLDAFADRTESVDRLDGVTVELQGTKA
WFNVRASNTEPLLRLNVEAPTAEEVDALVTEILGVIRQQ
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacccgtgaatcggtgaccaaggtcatcaaggcttatgacgtgcgaggggtcgtc
ggtgttgatattgatgctgacttcatccgcgaggtaggctcggcttttggccatctgatg
cgcaacgagggcgctactaaggtcgccgtaggtcatgacatgaggccgtcatcacctgag
ctaactcaggcttttgcagacgggctcaccgctcaaggcgttgatgtggttgcgctaggg
ctcacctccactgatcagctgtattacgcttctggcgttatggattgccccggcgcaatg
ttcaccgcatcccacaaccctgccgaatataacggcatcaagatgtgccgctctggcgca
cgacccgtggggcaggaaactggtttgggcgcgattatcgacatgctggtggagggcgtc
ccggcttacgacggcaaaccaggcgctattacgcagaaagataccctcgcggattacggt
tccttccttcgtgaacttgtggatctgtctggcatccggcctcttgttgttgctgtggac
gcagcgaacggcatgggtgggcatactgtccctgaggtttttgcaggacttccactcgat
gtcaagcccctctactttgagctagacggaaccttccctaaccatgaggcaaacccgctc
gaccccaagaaccttgtggacctgcaaaaattcactccagaggtaaaagccgacatcggc
ctagcttttgacggcgacgcagatcgctgctttgtggttgatgagaatggcgacccggtg
agcccctctgctatttgcgccatcgtcgcagagcgataccttgcgcagcatccaggcagc
acgattatccataacctgattacctccaagacggttccggaggtaatcgcggaaaatggc
ggtgttgccgtgcgtacgcgtgtgggacattcctttattaaggcacaaatggcggagcac
ggcgcggcattcggcggcgagcactctgctcattactacttctctgagtttttcaatgcc
gattctggaatccttgcagcaatgcacgtgctagcggctctaggcggacaagacaagcct
ttgtcagagctgatgaaagaatattcgcgttacgcggcatcgggagaaatcaactcacgt
ttggctagcgctgaagaacaggctgagcgcacccaggctgttctggatgctttcgcggat
cgtacggaaagcgttgatcgtctcgacggcgttaccgttgagcttcaaggcactaaggcg
tggttcaatgttcgcgcttccaacacagaaccacttttgcgtcttaacgtcgaggctcct
acggcagaagaagtggacgccctagtcactgaaattcttggggttattcgtcaacagtag

DBGET integrated database retrieval system