KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0611Help
Entry
CpC231_0611       CDS       T01877                                 

Gene name
echA6
Definition
(GenBank) Enoyl-CoA hydratase echA6
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
cpq00071  Fatty acid degradation
cpq00280  Valine, leucine and isoleucine degradation
cpq00310  Lysine degradation
cpq00360  Phenylalanine metabolism
cpq00380  Tryptophan metabolism
cpq00410  beta-Alanine metabolism
cpq00627  Aminobenzoate degradation
cpq00640  Propanoate metabolism
cpq00650  Butanoate metabolism
cpq00903  Limonene and pinene degradation
cpq01100  Metabolic pathways
cpq01110  Biosynthesis of secondary metabolites
cpq01120  Microbial metabolism in diverse environments
cpq01130  Biosynthesis of antibiotics
cpq01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cpq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CpC231_0611 (echA6)
   00650 Butanoate metabolism
    CpC231_0611 (echA6)
  Lipid metabolism
   00071 Fatty acid degradation
    CpC231_0611 (echA6)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CpC231_0611 (echA6)
   00310 Lysine degradation
    CpC231_0611 (echA6)
   00360 Phenylalanine metabolism
    CpC231_0611 (echA6)
   00380 Tryptophan metabolism
    CpC231_0611 (echA6)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CpC231_0611 (echA6)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CpC231_0611 (echA6)
   00281 Geraniol degradation
    CpC231_0611 (echA6)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CpC231_0611 (echA6)
   00627 Aminobenzoate degradation
    CpC231_0611 (echA6)
   00930 Caprolactam degradation
    CpC231_0611 (echA6)
Enzymes [BR:cpq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CpC231_0611 (echA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADL10096
UniProt: D9Q970
Position
646955..647641
Genome map
AA seq 228 aa AA seqDB search
MFEQTRDDDASRALKEIETVKVSSDGFVRHIVLDRDDRRNALSGDMCRAIAHAVTEASAA
AVDNASVRAIMISGVGRAFCAGADLGSSVREGGEHSSDGAVYGAGFHDALFAMLHSIIQA
EVPIIANVQGAAVGAGMQLALACDLRVVGESAWFKVPAVSLGFALDGWTIGRAQKLCGGA
FARNLLLAGASLTPDAALSSGFVAIRGDHAAAVAFAHEVAGLASLSVR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgaacaaactcgagacgatgatgcctcgcgggctttgaaagagatagaaactgtc
aaggtatcctccgatggttttgtgcgtcatatcgttttggatagagatgatcgccggaac
gctctttcgggtgatatgtgccgagctatcgcacacgccgtgactgaagcttctgctgcg
gccgtcgataatgcatcagtgcgtgcgatcatgattagcggagtaggacgagccttttgc
gcaggtgctgatctggggtcgtctgtgcgagaaggtggggaacattcctcggatggggcg
gtgtatggcgccggtttccatgatgcgctctttgctatgttgcattcgattattcaggca
gaggtgccgataatagctaatgtgcaaggggctgcggtaggtgctgggatgcagcttgct
ttggcgtgtgatctccgtgttgttggagagtctgcatggtttaaagtccccgctgtttct
ttggggtttgcgctggatggatggactatagggcgtgctcaaaaactctgtggcggtgct
tttgctaggaatttgttgcttgccggtgcatcattgaccccggatgcggctctgtctagt
ggttttgttgcaatccggggcgaccatgctgcagcagttgcttttgctcatgaagttgcc
ggattggcgtctctttctgtacggtag

DBGET integrated database retrieval system