KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0667Help
Entry
CpC231_0667       CDS       T01877                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CpC231_0667 (galU)
   00052 Galactose metabolism
    CpC231_0667 (galU)
   00500 Starch and sucrose metabolism
    CpC231_0667 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CpC231_0667 (galU)
Enzymes [BR:cpq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CpC231_0667 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
704011..704967
Genome map
AA seq 318 aa AA seqDB search
MDTGCTLICMKQPQEAQDSTRVAVKTVIVPAAGMGTRFLPATKTVPKELLPVVDTPGIEL
IAEEAAQLGATRLAVITAPNKQEVMEHFKRFPVLEETLQSRGKTEQYEKVVHASELIAPV
SVVQEKPLGLGHAVGMAESVLDPDEDAVAVMLPDDLVLPRGVVEKMVEVREQLGGSVLCA
FEVPEEEVYNYGVFEIDESAYDGPHHVKKVKGMVEKPSVEEAPSNFVATGRYLLDRAIFD
ALRRITPGAGGELQLTDAIDLLIDEGHPVHILVHDGKRHDLGNPGGYIPAVVDFGLRDPA
YGPHLKKVLRKILEEHGA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtggataccggatgtactcttatctgcatgaagcagcctcaagaagctcaagacagtacg
cgcgtcgcggtgaagactgtcatcgttcctgctgctggcatgggaacgagattccttcct
gccacaaaaacggttcctaaagaactgttaccagtggtagataccccaggcattgaactg
attgcagaagaagcagctcagttgggggcaactcgactcgcagtaattacggctcctaat
aagcaggaagtcatggagcactttaagcgattcccagtgttggaagagaccctacaaagc
cggggcaaaaccgaacaatatgaaaaagttgttcatgcctctgagcttattgcgccagtt
tccgtagtgcaggaaaagccgctcggccttgggcatgctgttggcatggcggaatcagtc
cttgatcctgatgaggatgccgtagcagtcatgcttcccgatgatctagtgcttccgcgg
ggcgttgtggagaagatggtcgaggtacgcgagcaactaggcggatccgtgttgtgcgcc
tttgaagtgccggaggaagaagtctataactacggtgtctttgagatcgatgagagtgca
tatgatggccctcatcacgtcaaaaaagtcaaaggaatggtagaaaaaccctctgtagaa
gaggctccttcaaattttgtggctaccggccgctatttgctcgatcgggctatttttgat
gcactccgtagaattaccccgggtgctggcggtgagctgcaactcacggatgccattgat
ttgcttatcgacgaaggccatcctgtgcatattcttgtgcatgacgggaagcgtcatgat
cttggcaaccccgggggatacataccggctgttgttgattttgggttgcgcgatccagcg
tatgggccgcacttaaagaaggtcctccgaaagattttggaagaacacggcgcataa

DBGET integrated database retrieval system