KEGG   Corynebacterium pseudotuberculosis C231: CpC231_1103Help
Entry
CpC231_1103       CDS       T01877                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:cpq01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpq01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cpq00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cpq00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cpq00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1207574..1208353)
Genome map
AA seq 259 aa AA seqDB search
MERKPLIAGNWKMNLDHMQAVATVQKLAFALPAEYYEKVDVAVTVPFTDLRSVQTVIDGD
KLQITYGAQDVSEHESGAYTGEISAAMLAKLGCTWVVVGHSERREYHDESSKLVAAKAKA
ALSKDISPIVCVGEPLTIREAGTHVDFVVEQTRESLAGLTEDELAKTVIAYEPVWAIGTG
KVASAADAQEVCKAIRGLIKELANEKIAAGIRILYGGSVKEETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAATGL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtaagccgctcatcgccggtaactggaagatgaatttagaccacatgcaagct
gtggcaacggttcagaagttagcgtttgcacttcctgccgaatactacgagaaagtggat
gtcgcagttactgtaccgttcacagatctacggtctgtccagactgtgattgatggagat
aaacttcagatcacgtacggcgcccaagatgtatcagagcatgaatcgggcgcttacact
ggagaaatctctgcagctatgcttgcaaagcttggctgtacatgggttgtggtggggcac
tcggagcgccgtgagtaccatgatgaatcttcgaaacttgttgcggcgaaggctaaagca
gcactgagcaaagatataagccctatcgtttgcgtcggtgagcccctaacgatccgggaa
gcaggaactcacgtagatttcgtcgtggagcaaacccgtgagtcgcttgcaggcctgacc
gaagacgagcttgctaagaccgttatcgcttatgagccggtttgggcaatcggtaccggg
aaggttgcttctgctgctgatgcccaagaggtgtgtaaagcaatccgcggtttgattaaa
gaacttgccaacgagaaaatcgccgcaggaattcgtatcctgtatggcggttctgtaaaa
gaagagacagtagcagagatcgtcggacaacccgatgtagatggtgggcttgtcggcggt
gcttctcttgatggcgaggcatttgccaagcttgcagctaatgcagctaccggtctttaa

DBGET integrated database retrieval system