KEGG   Corynebacterium pseudotuberculosis C231: CpC231_1172Help
Entry
CpC231_1172       CDS       T01877                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CpC231_1172 (ruvA)
Enzymes [BR:cpq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CpC231_1172 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1287801..1288412)
Genome map
AA seq 203 aa AA seqDB search
MIVSLRGTVASIGLGSAVIECNGVGYEVLASPSTLSQMRRGEEFFVLTTMVVREDSQTLY
GFASDEARQMFTLLQTVSGLGPKLALAAQSVLSAVDLAQAIANQDAKTLQRIPGVGKRVA
ERIIVDLKDKVSAFITDGGATPASGGSSSATSDVSAQVLEALLGLGFTEKVAEPALNSVL
SESPNATTSQALRLALSTLGKKK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtttcccttcgcgggactgtagcctccatcggtcttggtagcgcagttattgaa
tgtaacggggttgggtatgaggtgctcgctagtcccagcactttgtctcaaatgcgcaga
ggcgaagaattctttgtcctgactacgatggtggtcagagaagactcccaaactctttat
gggtttgctagtgatgaagctcggcagatgtttacgctgctgcagactgtctctggacta
gggccaaagctggcgttggcggcacaatcagtgttgtcagcagtggatttagctcaggcg
attgctaatcaggatgcaaaaactctacaacgtatccccggggtgggaaagcgagtcgca
gagcggattattgtcgacctcaaagacaaggtttcagcttttattaccgatgggggtgct
acccctgcgtcgggaggctcatcttctgcaacgagtgatgtttccgcacaggtgttggag
gctcttctcggacttggttttacagagaaagttgcagaacctgcgttgaattccgtgttg
agcgaatctccgaacgctactacatcccaggcgctgcggttagccctgagcacgctgggg
aaaaagaaatag

DBGET integrated database retrieval system